(data stored in ACNUC7421 zone)

EMBL: CP000251.PE81

CP000251.PE81        Location/Qualifiers
FT   CDS_pept        complement(99116..99790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0082"
FT                   /product="LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79859"
FT                   /db_xref="GOA:Q2IM29"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79859.1"
FT                   /translation="MIAAAWIAVTAALYAAARALHRRFPRPWLTPLLVVPGALAAVLLA
FT                   ARVPYPGYMRGGRLLVDLLGPATVAFALPLHRHAGLLRRHAAELCAGILAGCAVAVGSS
FT                   FLLARALGLGRPLALSLAPRSITTPFAMQVAGDLGGVPALAAVFVILTAVVGLVVGQLL
FT                   LRWLPLRSAVARGALFGMGAHAAGTAQAMELGRVEGAVAGVVMIVAGLGVLVATPLLRL
FT                   AL"
     gtgatcgccg ccgcctggat cgccgtcacc gccgcgctgt acgcggccgc ccgggcgctg        60
     caccgccgct tcccgcggcc gtggctcacg ccgctgctgg tcgtgccggg cgcgctcgcc       120
     gcggtgctgc tcgccgcgcg cgtgccgtac cccggctaca tgcgaggcgg gcggctgctg       180
     gtcgatctcc tcggcccggc cacggtggcg ttcgcgctgc cgctccaccg ccacgccggg       240
     ctgctccgcc ggcacgccgc cgagctctgc gccgggatcc tggccggctg cgcggtggcg       300
     gtggggagct cgttcctgct cgcccgcgcg ctcggcctcg gccggccgct cgcgctcagc       360
     ctggcgcccc gctccatcac cacgccgttc gcgatgcagg tggccggcga cctcggcggc       420
     gtgccggcgc tggcggcggt gttcgtgatc ctcacggcgg tggtgggcct ggtggtgggg       480
     cagctcctcc tccgctggct cccgctccgg agcgcggtcg cgcgcggcgc gctgttcggc       540
     atgggcgcgc acgccgccgg caccgcgcag gccatggagc tggggcgcgt cgagggcgcg       600
     gtggcggggg tggtgatgat cgtcgccggc ctgggcgtgc tggtcgcgac gccgctcctc       660
     cggctggcgc tctag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page