(data stored in ACNUC7421 zone)

EMBL: CP000251.PE87

CP000251.PE87        Location/Qualifiers
FT   CDS_pept        106372..107058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0088"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79865"
FT                   /db_xref="GOA:Q2IM30"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79865.1"
FT                   /translation="MTPSLALALPLALTLAASAPVTPPAPAEAGRAAAARTLEDPRALA
FT                   RKVQAFYERTRDLEARFRQTYVYAGFGRRQTSSGTLRVKKPGMMRWDYEKPAPKTVAVK
FT                   GSRLVQYEPEENQAYVDEAFDSSAMSAAVTFLLGKGDLLREFDVSLDGAGALLLRPKEA
FT                   DPRVESIALTVAADGQVTATRVVDGAGNANEIRFEDVRRNVGLPDAAFEVKLPRDVRRI
FT                   AAPKAQ"
     atgaccccga gcctcgccct cgccctgccc ctcgcgctca ccctcgccgc gtccgccccg        60
     gtcacgcccc ccgcccccgc ggaggccggc cgcgccgcgg cggcgcgcac gctcgaggat       120
     ccccgcgcgc tcgcgcggaa ggtgcaggcg ttctacgagc ggacccgcga cctcgaggcg       180
     cgcttccgcc agacctacgt ctatgccggc ttcggccggc gccagacgtc ctccgggacg       240
     ctgcgcgtga agaagcccgg gatgatgcgc tgggactacg agaagccggc cccgaagacg       300
     gtggcggtga agggctcgcg cctggtgcag tacgagccgg aggagaacca ggcctacgtg       360
     gacgaggcgt tcgacagctc ggccatgagc gcggcggtga cgttcctgct cggcaagggc       420
     gacctcctgc gcgagttcga cgtctcgctg gacggcgccg gcgcgctgct gctccggccg       480
     aaggaggccg acccacgggt cgagtccatc gcgctcacgg tggcggcgga cgggcaggtg       540
     accgccaccc gcgtggtgga cggggccggg aacgcgaacg agatccgctt cgaggacgtg       600
     cggcggaacg tgggcctgcc cgacgccgcg ttcgaggtga agctcccccg ggacgtccgc       660
     cggatcgcgg cgccgaaggc gcagtag                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page