(data stored in ACNUC7421 zone)

EMBL: CP000251.PE89

CP000251.PE89        Location/Qualifiers
FT   CDS_pept        108646..110064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0090"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79867"
FT                   /db_xref="GOA:Q2IM36"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79867.1"
FT                   /translation="MLDVADAALRAAVADAVREARRRSAEAVAWMRVALRAAILLVYLP
FT                   GWHGTAAWHAAALRVSAAYLAVAVGVLVLLRRRWRWEAVALAAAAVDLAFVAVGSWRVV
FT                   ALAGGDLALAIAAGAGNGMMLMVILFAAVALPPAPAAALSVIAIANQMALAAHSGVSWR
FT                   LVLLVGLILSAAAIVAIRNTLRATALGARLAAESYTASLCRAHGEALARANAEALAQRD
FT                   EVITAHRQARDLVRLMVHDLKNPLAALLQYLRLAEVELRGQPDAAQVREDLAQAEGEGQ
FT                   RLAEMIGDLLAISRLETGPARLAADPVAIEDLLQAVARSCAAHARERGVTISVRGGDDL
FT                   VVRLDRDLSRRLLENLVANALRHCRTGDRIELAGEADGEGVRLAVRNSGPPVPPAIRAH
FT                   LFEKFAPGEAREWTSAGLGLYLCRLVAEAHGGGVALVDTPGWTVSFEARLAPARTGGEA
FT                   APRAAAVAPERRPG"
     atgctcgatg tggcggacgc ggcgctccgc gcggcggtgg ccgacgcggt gcgcgaggcg        60
     cggaggcgca gcgccgaggc ggtggcctgg atgcgcgtgg cgctccgcgc cgccatcctg       120
     ctcgtctacc tcccgggctg gcacggcacg gccgcgtggc acgccgccgc gctccgcgtg       180
     agcgccgcgt acctggcggt cgcggtgggc gtcctggtcc tgctgcggcg ccggtggcgc       240
     tgggaggcgg tggcgctcgc cgcggcggcc gtcgatctcg cgttcgtggc ggtgggcagc       300
     tggcgggtgg tcgcgctggc gggcggcgat ctcgcgctcg ccatcgcggc cggcgccggc       360
     aacggcatga tgctgatggt catcctgttc gcggcggtgg ccctgccgcc ggcgccggcc       420
     gcggcgctct cggtgatcgc gatcgcgaac cagatggcgc tcgcggcgca ctccggcgtg       480
     tcctggcggc tggtgctgct ggtcggcctc atcctctccg cggccgcgat cgtcgccatc       540
     cggaacacgc tgcgcgcgac ggcgctcggg gcccggctcg cggccgagag ctacaccgcc       600
     tcgctgtgcc gggcccacgg cgaggcgctg gcgcgcgcga acgccgaggc gctggcgcag       660
     cgcgacgagg tgatcaccgc gcaccgccag gcccgcgatc tcgtgcgcct gatggtgcac       720
     gacctcaaga acccgctcgc cgcgctgctc cagtacctgc gcctcgccga ggtcgagctg       780
     cgcgggcagc cggacgcggc gcaggtgcgc gaggacctgg cgcaggcgga gggcgagggc       840
     cagcggctcg ccgagatgat cggcgacctg ctcgccatct cgcgcctgga gaccgggccg       900
     gcccgcctcg ccgcggatcc ggtggcgatc gaggacctcc tgcaggcggt ggcgcggagc       960
     tgcgcggcgc acgcgcggga gcgcggcgtg accatctcgg tgcgcggcgg ggacgacctg      1020
     gtggtccgcc tcgaccgcga cctgtcgcgc cggctgctcg agaacctggt cgcgaacgcg      1080
     ctccgccact gccggaccgg cgaccggatc gagctcgcgg gcgaggcgga cggggagggg      1140
     gtgcggctcg cggtccggaa ctccgggccg ccggtgccac ccgccatccg cgcccacctg      1200
     ttcgagaagt tcgcgcccgg cgaggcgcgc gagtggacca gcgccgggct ggggctgtac      1260
     ctgtgccggc tggtggcgga ggcgcacggc ggcggggtgg cgctggtgga cacgccgggc      1320
     tggaccgtca gcttcgaggc gcggctcgcc ccggcccgga ccggcgggga ggcggcgccg      1380
     cgcgcggccg cggtggcgcc ggagcgccgg ccgggctaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page