(data stored in ACNUC7421 zone)

EMBL: CP000251.PE91

CP000251.PE91        Location/Qualifiers
FT   CDS_pept        111181..111621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0092"
FT                   /product="Hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79869"
FT                   /db_xref="GOA:Q2IM34"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79869.1"
FT                   /translation="MGMEWTARLAVGIDDIDAQHQELFRRVNGLVTAMGERRGREELAE
FT                   VVAFLRAYVDVHFAAEARLMARSRYPGRAFHAAEHAHFRAQVEELAARIAAEGPESHHA
FT                   VKLAGILCEWLRQHVLLTDRQLADHVRAEDLLDDGWRGGGEG"
     atgggcatgg aatggaccgc gcggctcgcg gtcggcatcg acgacatcga cgcacagcac        60
     caggagctgt tccgcagggt gaacgggctc gtcacggcca tgggcgagcg ccgcggccga       120
     gaggagctcg ccgaggtggt cgcgttcctc cgcgcgtacg tggacgtcca cttcgccgcg       180
     gaggcgcggc tcatggcgcg cagccggtac cccgggcgcg cgttccacgc ggccgagcac       240
     gcgcacttcc gcgcgcaggt ggaggagctc gccgcgcgca tcgccgccga gggcccggag       300
     tcgcaccacg cggtgaagct ggccgggatc ctctgcgagt ggctgcggca gcacgtgctg       360
     ctgaccgacc ggcagctcgc ggaccacgtg cgggcggagg acctgctcga cgacgggtgg       420
     cggggcgggg gtgaggggtg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page