(data stored in ACNUC7421 zone)

EMBL: CP000270.PE102

CP000270.PE102       Location/Qualifiers
FT   CDS_pept        122332..123411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4360"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4360"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28640"
FT                   /db_xref="GOA:Q146U9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U9"
FT                   /protein_id="ABE28640.1"
FT                   /translation="MCVVTLVFDGGAAHNAGMNDDILDPQDGANSAVPFARLKPEIVLD
FT                   ALDGVLSTVGVRTDGRMLPLNSYENRVYQVGVEDGPPVVAKFYRPERWSDAAILEEHAF
FT                   VADLASREIPAVPARVFEGRTLHSFDGFRFSIFERRGGRAPDLDRPDTLEWLGRFIGRI
FT                   HAVGQTQNYVERPTLDIHTFGYEPRDFLLAHRFVPDNLRTAWETVVNLALEGVERAFER
FT                   AGDIRMLRMHGDCHPSNVLWTDAGPHFVDFDDSRMGPAVQDLWLLLPGERAEASRALAD
FT                   LLAGYEDFCDFEPRELYLVEALRTLRLIHYQAWLARRWDDPAFPAAFPWFNTQRYWEDR
FT                   ILELREQIGAMQEGPLWPV"
     ttgtgcgtcg tcaccctcgt ctttgacggc ggcgcggcgc acaatgccgg catgaacgac        60
     gacattctcg atccacagga cggcgcgaac agcgctgtgc ctttcgcccg gctcaagccg       120
     gaaatcgtgc tcgacgcgct cgacggcgtg ctcagcacag tcggcgtgcg caccgacggc       180
     cgcatgctgc cgctcaacag ctacgagaac cgcgtgtacc aggtcggcgt ggaagatggc       240
     ccgcccgtgg tcgcgaagtt ctatcggccc gagcgctgga gcgacgccgc gattctcgaa       300
     gaacatgctt tcgttgccga tctcgcttcc cgcgaaattc cggcggtgcc tgcgcgcgtt       360
     ttcgaaggcc gcacactgca tagcttcgac ggtttccgct tctcgatctt cgagcgtcgc       420
     ggcggccgcg cgccggatct cgaccggccc gacacgctgg aatggctcgg gcgtttcatc       480
     ggccgcatcc atgcggtggg tcagacgcag aattacgtcg aacgtcccac gctggacatt       540
     cacaccttcg gctacgagcc gcgcgacttc ctgctcgcgc accgtttcgt accggacaac       600
     ctgcgcaccg catgggaaac cgtggtgaac ctcgcgctcg aaggcgtgga gcgcgcgttc       660
     gagcgggccg gcgacatccg catgctgcga atgcatggcg actgtcatcc gagcaacgtg       720
     ttgtggaccg acgcagggcc gcatttcgtc gacttcgacg acagccgcat gggaccggcg       780
     gtgcaggatc tgtggctgtt gctgccgggc gagcgcgcag aagcgtcgcg cgcgctggcg       840
     gatctgctcg caggctatga agacttttgc gacttcgagc cgcgcgaact ctatctggtc       900
     gaagcgttgc gcacgctgcg gctgattcac tatcaggcgt ggctcgcgcg ccgctgggac       960
     gacccggcgt tccccgcagc gtttccgtgg ttcaacacgc agcgttactg ggaagaccgc      1020
     atcctcgaat tgcgcgagca gatcggcgcg atgcaggaag ggccgctttg gcccgtttga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page