(data stored in ACNUC7421 zone)

EMBL: CP000270.PE103

CP000270.PE103       Location/Qualifiers
FT   CDS_pept        complement(123449..125350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4359"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4359"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28641"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U8"
FT                   /protein_id="ABE28641.1"
FT                   /translation="MRLSSLVCLASFGWLAGIHGAGASVAARLDDPYTNEGETQTFTVN
FT                   ADGSYSKLDSMTLLVNNEAGVARVAQQYVWFNRNMADVQIIEAYTITADGVRHDVQPDQ
FT                   IRDVQEARSFDAPMFQDIQEKVIVFPAVEPGARVHLTYRKTQKQPIVPGQFSDFTPPDL
FT                   APTHNFRLIYDLPAGKPLYADARGFTVVQPVTREGRTRYEYRYDKAHFSRLERGSVAYV
FT                   SYGDRLMVSTFPDYAAFAATYRESAADPSAHDAAVTRLAQQLTAHDRTPRDKAKTLYDW
FT                   VRRNVRYVAINVGRGAVVPHGASAVLANRYGDCKDHVALYGALLDAAGVRNEPALISSG
FT                   TIYTLPSVPGYGVINHIITWLPDLQQYADSTASNVEFGFLPPSDMNRPTVLVGEGVLSR
FT                   TPATALLTRSTDLSIKVEPDGSASFTYRLEAAGASAEQTRAMLRTQTPAQREESIQAEL
FT                   RSANLRGTATLTTNDLTVADGPLTITMKGRLESLVVPGAAASIPALTSLAGGFEADTRY
FT                   WLGERQRTQPFICRNQALHERARIELPANFRVLDVPEAKRTQDRFVDFQSQYTFDPQSN
FT                   VVTMTRDGATHFDSDVCTPDDFAQMRPTIEAIGRDVRAEVIVKSTLAEPSSVASQAP"
     atgcgccttt cttccctggt ttgtcttgcc tccttcggct ggcttgccgg catccacggc        60
     gcgggggcga gcgtcgcggc cagactggac gatccctata ccaacgaagg cgagacgcag       120
     accttcaccg tcaacgcgga cggctcctat tcgaagctcg attcgatgac actgctcgtg       180
     aacaacgaag cgggcgtcgc gcgggtcgct cagcaatatg tctggttcaa ccgcaacatg       240
     gcggacgtgc agatcatcga ggcctacacg atcaccgccg acggcgtacg tcacgacgtg       300
     cagcccgatc agatccgcga cgtccaggaa gcccgctcgt tcgacgcacc gatgtttcag       360
     gacattcagg aaaaggtgat cgtgtttccc gccgtggaac cgggcgcgcg tgtgcatctc       420
     acctatcgca agacgcagaa gcagccgatc gtgccgggcc agttcagcga cttcacgccg       480
     cccgatctcg cacccacgca caacttccgc ctgatctacg atctgcccgc cggcaagccg       540
     ctttatgccg acgcgcgcgg cttcaccgtc gtgcagcccg tgacgcgcga aggccgcacg       600
     cgctacgaat atcgctacga caaggcgcat ttcagccgcc tggagcgcgg ctcggttgcg       660
     tacgtgtcgt acggcgaccg gctgatggtc tcgaccttcc cggactacgc cgcgttcgcc       720
     gcaacctacc gggaatccgc cgcggacccg agcgcgcacg acgccgccgt cacgcgtctc       780
     gcgcaacagc tcaccgcgca cgaccgcacg ccgcgcgaca aagccaagac gctgtacgac       840
     tgggtacgcc gcaatgtgcg ctatgtagcg atcaacgtcg ggcgcggcgc ggtggtgccg       900
     cacggcgcga gcgcggtcct cgcgaaccgc tacggcgact gcaaggatca cgtcgcgctt       960
     tacggcgcgt tgctcgacgc ggccggcgtg cgcaacgagc cggccctgat cagcagcggc      1020
     acgatctaca cgctgccgag cgtgccgggg tacggcgtca tcaatcacat catcacgtgg      1080
     ctaccggatt tgcagcagta cgccgattcg accgcgtcga atgtcgaatt cggttttctg      1140
     ccgccctccg acatgaaccg gccgaccgtg ctcgtcggcg agggtgtgct ctcgcgcacg      1200
     cccgccacgg cgctcctgac gcgcagcacc gacctgtcga tcaaggtcga accggatggc      1260
     tcggcgagct tcacgtaccg gctggaggcg gccggcgctt ccgccgaaca gacgcgcgcc      1320
     atgctgcgca cgcaaacacc cgcacagcgc gaggaatcga ttcaggccga attgcgcagc      1380
     gccaacctgc gcggcaccgc cacgctcacc acgaacgacc tcaccgtggc cgacggcccg      1440
     ctcaccatca cgatgaaagg caggctggaa agtctcgtgg tgcccggcgc ggcggcgtcg      1500
     attccggcgc tgacgagtct ggccggcggc ttcgaggcgg atacgcgcta ctggctgggc      1560
     gagcgccagc gcacgcagcc gttcatctgc cgcaaccagg cgctgcatga acgcgcgcgc      1620
     atcgagttgc ccgccaattt tcgcgtgctc gacgtgccgg aggcgaagcg gacccaggac      1680
     cgctttgtcg atttccagtc gcagtacacg ttcgacccgc aaagcaacgt ggtcacgatg      1740
     acgcgcgacg gcgccacgca tttcgatagc gacgtctgca cacccgacga cttcgcgcag      1800
     atgcgcccca cgatcgaagc gatcgggcgc gacgtgcgtg ccgaagtaat tgtcaaatcg      1860
     acgctggcgg agccgtcgag cgttgcttcg caggcgccgt ga                         1902
//

If you have problems or comments...

PBIL Back to PBIL home page