(data stored in ACNUC7421 zone)

EMBL: CP000270.PE109

CP000270.PE109       Location/Qualifiers
FT   CDS_pept        complement(130597..131394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4353"
FT                   /product="Putative carbon monoxide dehydrogenase, medium
FT                   subunit (CoxM)"
FT                   /EC_number="1.2.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4353"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28647"
FT                   /db_xref="GOA:Q146U2"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U2"
FT                   /protein_id="ABE28647.1"
FT                   /translation="MYSFEYQRATDPKAAAASLTADSDAKFLAGGQSLLPTMRLRLAQP
FT                   SQLIDVTRIPALKSITVDGKTVTIGAAVCHADVADHAELRRVSPALADLAAHIGDRQVR
FT                   ALGTIGGSLANNDPAACYPAAAMALDATIVTDRRRITSGDFFVGMYETALAPDELIVAV
FT                   EFPVPERAAYEKFRNPASHFALVGVFVAKFASGVRVAVTGAAASVFRVPELESALSANF
FT                   APEAARAVTVSGADLNTDMHASAEYRAHLIPVLAARAVTKANA"
     atgtattcat tcgagtatca acgcgcgacg gatccgaaag cggccgccgc cagcctcacc        60
     gccgacagcg acgcgaagtt tctggccggc ggccaaagcc ttttgcccac catgcggctg       120
     cgtctcgcgc agccgtcaca actgatcgac gtgacgcgca ttcccgcgct gaagtcgatc       180
     acggtcgacg gaaaaacggt gacgatcggc gccgccgtgt gtcatgccga tgtcgcggat       240
     cacgcggaac tgcggcgcgt atcgccggcg cttgcggatc tcgccgcgca tatcggcgat       300
     cgccaggtgc gcgcgctcgg cacgatcggc ggctcgctcg ccaacaacga cccggccgcc       360
     tgttatccgg ccgcggcgat ggcgctggac gcgactatcg tcacggaccg gcggcgcatt       420
     acgtcgggcg attttttcgt cggcatgtat gagacggcgt tggcgcccga cgaactgatc       480
     gtcgccgttg agtttccggt gccggagcgc gccgcgtacg agaaattccg caatccggct       540
     tcgcacttcg cgttggtcgg cgtgttcgtc gcgaagttcg cgagcggcgt gcgcgttgcg       600
     gtgacgggcg cggcggcgtc ggtgtttcgt gtaccggagc tggaaagcgc gttgtcggcg       660
     aacttcgcgc ccgaagccgc ccgcgcggtg acggtgtcgg gcgccgacct gaacacggac       720
     atgcacgcga gcgccgaata tcgcgcgcat ctgattccgg tactggcggc acgcgcggtg       780
     acgaaggcga acgcttag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page