(data stored in ACNUC7421 zone)

EMBL: CP000270.PE11

CP000270.PE11        Location/Qualifiers
FT   CDS_pept        complement(15111..16586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4452"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28549"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E0"
FT                   /protein_id="ABE28549.1"
FT                   /translation="MSRTQEKHNRSVSKDVLVVGGGTSGFVAAIAAARNGASVLLLEQR
FT                   DHLGGTHSGGMVMMIRSMRHMKAPANMEQKKIMMTGYESSFDDEQVVRSIVQEYINRML
FT                   EIGSAWGRKDEATARQMFDPEIAKWVIQDMVAEAGVEVWLNTQATDVIMEGNALKGVVI
FT                   ESLRDRVEVHAGITIDTTGDGDIAAAAGAAFEFGSPEDGKCQPASLYFAVGGVQLDKTI
FT                   AYMRDHANEFGEEYVKTMVGLKEQNKPITMFPFKEKIREALKNGDYPIPYGVETVNPDT
FT                   LSYIVRPMFRNGKFRYDVTYHNMDMAYNFDATDRVELTKATLAMRDLANKMAKFYRKYV
FT                   PGYEDSYLSYTAQSVGIRDSRRIVCDYTLTREDVLAGQVFPDGIGRYGSLMDVHDKSGK
FT                   KSLSLVEVGGHGWFHVPFRSLLPKGIENLMVAGRCISADYDAQGSVRSQAASMVTGQAT
FT                   GTAAALAVQQKRKLRELDVSALQEVLKAQNQVI"
     atgagtcgaa cccaagagaa gcacaaccgg tcagtgagca aggatgtttt agtcgtcggc        60
     ggcggcacgt caggctttgt cgcagcgatt gcggcggcga gaaacggcgc cagtgtgttg       120
     cttctcgagc agcgcgatca cctgggtggc acccattcgg gcggcatggt gatgatgatc       180
     cgttcgatgc gtcacatgaa ggcaccggcc aacatggagc agaagaagat catgatgacg       240
     ggctatgaaa gctcgttcga cgacgagcag gtcgtgcgct ccatcgtgca ggaatacatc       300
     aaccggatgc tggagatcgg ttccgcgtgg ggccgcaagg acgaggcaac ggcgcgccag       360
     atgttcgatc cggaaatcgc gaagtgggtc attcaggaca tggtggccga agcaggcgtg       420
     gaagtgtggc tcaacacgca ggcaaccgac gtcatcatgg aaggcaacgc gctcaagggc       480
     gtcgtgatag aaagcctgcg cgaccgcgtt gaagttcatg ccggcatcac catcgacacg       540
     accggcgacg gcgatatcgc ggcggcggcc ggcgcggcgt tcgaattcgg ctcgccggaa       600
     gacggcaagt gtcagcctgc cagcctgtat ttcgcggtag gcggcgtaca gctcgacaaa       660
     acgatcgcct atatgcgcga ccacgccaac gagttcggcg aggaatacgt gaagacgatg       720
     gtcggcctga aggagcagaa caagccgatc acgatgttcc cgttcaagga aaaaatccgc       780
     gaagcgctca agaacggcga ctacccgatt ccttacggcg tcgagaccgt caaccccgat       840
     acgctgagct acattgtccg gccgatgttc cgtaacggca agtttcgcta cgacgtgacc       900
     tatcacaaca tggacatggc gtacaacttc gatgcgactg atcgcgtcga gctcacgaag       960
     gccacgctcg ccatgcgcga cctcgccaac aagatggcga agttttatcg gaagtacgtg      1020
     ccggggtatg aggattccta tctttcgtac accgcgcagt cggtcggcat ccgcgacagc      1080
     cgccgcattg tgtgcgacta caccctcacg cgtgaagacg tgctcgccgg gcaggtgttc      1140
     ccggacggca tcggccgtta cggcagcctg atggacgtgc atgacaagtc gggcaagaag      1200
     tcgctgagtc tcgtcgaagt gggcggtcac ggctggttcc atgtgccgtt ccgctcgttg      1260
     ctgccgaagg gcatcgaaaa cctgatggtg gccggccgtt gcatttccgc cgactacgac      1320
     gcgcaaggca gcgtacgttc gcaagccgcc agcatggtga ccggtcaggc gacgggcact      1380
     gccgccgcgc tggctgtgca gcaaaagcgc aagttgcgcg agctcgacgt ctcggcgctt      1440
     caggaagtgc tcaaggcgca gaaccaggtg atctga                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page