(data stored in ACNUC7421 zone)

EMBL: CP000270.PE120

CP000270.PE120       Location/Qualifiers
FT   CDS_pept        complement(144125..145096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4342"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4342"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28658"
FT                   /db_xref="GOA:Q146T1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T1"
FT                   /protein_id="ABE28658.1"
FT                   /translation="MTAAPRATAATTVRKWRHLAMQREVIVLLAMVLFNLFFTPHFWSL
FT                   QTFNVNMTQVVTIVIVGIGMTLVVATGGIDLSVGASMAISGALAPMLFLNIAGPGGIAL
FT                   AFVLPVLAAALCGVFNGLLVTRLSVQPIVATLVLFIAGRGIAQVVTDGSLQAFNTPAFQ
FT                   WIALGKVAGVPFQVLLMLALVALFVWVVRKTLFGQYLLITGGNEKAAYLCGVPTATVKL
FT                   IAYTLCAALAGLAGLISISVNSSSDANVVGLGVELDAIAAVAVGGTALTGGKAYIGGTL
FT                   IGALIIQLLRYTLLAHGIPDAAALVVKAGIIVAAVYVQRRSR"
     atgacggccg cgccgcgcgc cacggcggcc accaccgtgc gcaaatggcg ccatctcgcc        60
     atgcagcgcg aagtgatcgt tctgctcgcg atggtgctgt tcaacctgtt cttcacgccg       120
     cacttctggt cgctacaaac cttcaacgtc aacatgacgc aggtggtgac gatcgtgatc       180
     gtcggcatcg gcatgacgct ggtggtggcg acgggcggca tcgatctgtc ggtgggcgcc       240
     tcgatggcga tctccggtgc gctcgcgccg atgctgttcc tgaacattgc cggtcccggc       300
     ggcattgcgc tcgcgttcgt gctgccggtg ctggccgccg cgttgtgcgg cgtcttcaac       360
     ggcttgctgg tgacgaggtt atccgtgcag ccgattgtcg cgacgctggt gctgttcatt       420
     gccggccgcg gcatcgcgca ggtcgtcacc gacggcagcc tgcaggcgtt caacacgccc       480
     gccttccagt ggatcgcgct cggcaaggtg gcgggcgtgc cgttccaggt gctgctgatg       540
     ctcgcgctgg tcgccctgtt cgtgtgggtc gtgcgcaaga cgctgttcgg ccagtatctg       600
     ctgattaccg gcggcaacga aaaagctgct tatctgtgcg gcgtgccgac ggccaccgtg       660
     aagctgatcg cctacacgct gtgtgcggcg ctcgcgggac tggcggggtt gatctcgatc       720
     tcggtgaatt cgtcctcgga tgcgaacgtg gtcgggctcg gcgtcgagct cgatgcgatc       780
     gcggcagtcg ccgtcggcgg caccgcgctc accggcggca aagcgtatat cggcggcacg       840
     ctgatcggcg cgctgatcat ccagttgctg cgctacacgc tgctcgcgca cggcattccc       900
     gacgcggcgg cgctggtggt caaggccggc attatcgtcg ccgccgttta tgtgcagcgg       960
     cgctcgcggt aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page