(data stored in ACNUC7421 zone)

EMBL: CP000270.PE121

CP000270.PE121       Location/Qualifiers
FT   CDS_pept        complement(145152..146786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4341"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4341"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28659"
FT                   /db_xref="GOA:Q146T0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T0"
FT                   /protein_id="ABE28659.1"
FT                   /translation="MTESGKETPHSPLTRSPLLDMQDIGISFGGVPALRGAHLSVAAGE
FT                   VHALIGQNGAGKSTMIKILTGAYRRGSGSVRFEGREVDFRTPKQAREAGISTIYQEINL
FT                   VPFRSVAENIFLGREPRRFGLIDWRAVQQRAAALLESFGLQIDVKKPVGRYSTAIQQMV
FT                   ALARAVSSDAKMVIMDESTSSLDEREVELLFTVVRKLRDDGRAVIFVSHRLDELYALCD
FT                   RVTVMRDGQTVAQSAMAEMDKLQLVTTMLGRTLAAVVQEDAEAREANLARRGKQMIAAT
FT                   HLSAHPKVSDVSLEVHAGEAVGLAGLLGSGRTETMRLMFGADPLERGSLAIGGENVALK
FT                   SPQDAISRGLAYLTEDRKAEGIVPELSVRDNLTLVCLRTLAKNGVVDVKKQQAIVDRFI
FT                   ASLGIKLRSPDQPIRELSGGNQQKVLLARWLAAEPSLLLLDEPTRGIDVGAKADVAKIV
FT                   RESRDAGLAVLLSASELEELTAVADRAVVIRDGRTVAELNGADMSETAIMDAIAYGSDG
FT                   HSPLADAAQTATAAHIEDALEGDRHGA"
     gtgacggaat ccggcaaaga gacgccacac tctcccctta cccgttcgcc gctgctcgac        60
     atgcaggaca tcggcatcag cttcggcggc gtgcccgcgt tgcgcggcgc tcatctgagc       120
     gtcgccgccg gcgaagtgca tgcgctgatc ggccagaacg gcgcgggcaa atcgaccatg       180
     atcaagatcc tgaccggcgc ctatcggcgc ggctcgggca gcgtgcgctt cgaaggccgc       240
     gaggtcgatt tccgcacgcc caagcaggcg cgcgaagccg gcatcagcac gatctatcag       300
     gagatcaatc tggtaccgtt ccgctcggtg gcggagaaca ttttcctcgg ccgcgaaccg       360
     cgccgttttg gtttgatcga ctggcgcgcg gtacagcaac gcgccgccgc gctgctcgaa       420
     tcgttcggct tgcagatcga tgtgaagaaa ccggttggcc gctattcgac cgccattcag       480
     cagatggtgg cactggcgcg tgcggtgtcg tcggacgcga agatggtcat catggacgag       540
     tccacctcgt cgctcgacga acgcgaagtg gagttgctgt tcaccgtggt gcgcaagctg       600
     cgcgacgacg gccgcgcggt gatcttcgtg tcgcacaggc tcgatgaact gtacgcgctg       660
     tgcgaccgcg tcacggtgat gcgcgacggc cagacggtcg cgcaaagcgc gatggcggag       720
     atggacaaac tgcagctcgt cacgacgatg ctcggccgca cgctcgccgc tgtcgtccag       780
     gaagacgcgg aagcacgcga agcgaacctc gcgcgccgcg gcaagcagat gatcgcggcg       840
     acgcatctga gcgcgcatcc gaaagtgagc gacgtctcgc tcgaagtgca tgccggcgaa       900
     gccgtgggtc tcgcgggcct gctcggctcg ggccgcacgg aaaccatgcg gctaatgttc       960
     ggcgccgatc cgctggagcg aggttcgctt gcgatcggcg gtgagaacgt ggcgctgaag      1020
     tcgccgcagg acgcgatctc gcgcgggctt gcctatctca ccgaagaccg caaggccgaa      1080
     ggcatcgtcc ccgaactctc ggtgcgcgac aacctcacgc tcgtctgtct acgcacgctg      1140
     gcgaagaacg gcgtggtcga cgtgaaaaag cagcaggcga tcgtcgatcg cttcattgcg      1200
     tcgctcggca tcaagctgcg ctcgccggat cagcctatcc gcgagctgtc gggcggcaat      1260
     cagcagaaag tgctgctggc gcgctggctg gcggccgagc cctcactgtt gctgctcgac      1320
     gaaccgacgc gcggtatcga cgtcggcgcg aaagcggacg tagcgaagat cgtgcgcgaa      1380
     tcgcgcgacg cgggcctcgc cgtactgctg tccgcctccg agctggaaga actgacggcc      1440
     gtggccgacc gcgccgtggt gatccgcgac ggccgcacgg tcgccgaact gaacggcgcc      1500
     gacatgagcg agaccgcgat catggacgcc attgcctacg gcagcgacgg ccattcgcca      1560
     ctggccgatg ccgcgcaaac ggcaaccgcc gcacacatcg aagacgcgct ggagggcgac      1620
     cgtcatggcg cttaa                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page