(data stored in ACNUC7421 zone)

EMBL: CP000270.PE129

CP000270.PE129       Location/Qualifiers
FT   CDS_pept        155118..155429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4333"
FT                   /product="Putative high potential iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4333"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28667"
FT                   /db_xref="GOA:Q146S2"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S2"
FT                   /protein_id="ABE28667.1"
FT                   /translation="MKSSRRTFLITSIGVASTFALSRQAFADAPKVSESDPTAQALGYK
FT                   EDASKVDKAKFAKYAAGQDCGNCSFFQGKPTDAYAPCPMFAGKQVAAKGWCSAYNKKA"
     atgaaatcat cacgtcgtac gtttttgatc accagcattg gtgtggcttc cacctttgcg        60
     ctgtcgcgcc aggcatttgc cgacgcgccg aaagtctccg aatccgatcc gaccgcgcaa       120
     gcactcggct acaaggagga cgcgagcaaa gtcgacaaag cgaaattcgc caagtacgca       180
     gcaggccagg actgcggcaa ctgcagcttc ttccagggca agccgaccga cgcctacgct       240
     ccttgcccga tgttcgccgg caagcaggtc gcggcgaagg gttggtgcag cgcatataac       300
     aagaaggcct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page