(data stored in ACNUC7421 zone)

EMBL: CP000270.PE137

CP000270.PE137       Location/Qualifiers
FT   CDS_pept        complement(164040..165494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4325"
FT                   /product="Putative hemagglutinin-related transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4325"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28675"
FT                   /db_xref="GOA:Q146R4"
FT                   /db_xref="InterPro:IPR031929"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R4"
FT                   /protein_id="ABE28675.1"
FT                   /translation="MNRKFKLTAIAMCVTSMIILTGCGSTLTRPGTGSGAGAGAGGGSG
FT                   GGTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSANPIGVVVQNTGNVITATGQTVSAVGS
FT                   QIGLTPIPGANPATTTALGNVVSNLGNGVTAVGTGVANGLGQLGNSTNPLGTTLGSSGN
FT                   LVYDAGQAVNSAGQLVTSLGSGPTAPLSALTTPLGSTVSTVGNAVSGLGTQLGSQLTNG
FT                   PIQQVTQTVSTAITPITSTLAQTTQTVGDTTGLGAPLNGLLSTIGHGLDSAGGKLSGAT
FT                   GNPVGQNLGNVVTKLGDTVTSAGGLLTAGAPSSGNPLGGITGILNPGSGAGTGSPLAPL
FT                   TSILTALPGTLSGGLTGGSGAGGPLAPLTSVVSSLTGSLGGLGGTGSGSPLAPLTGVVS
FT                   SVTGALSGATNSSGNPLAPVTSAVSSLTGALGSATGSGGGGSNPLAPVTGLLTTVTGAL
FT                   SGAATSAGGTTGGGLLGGLGALAIRK"
     atgaatcgca aattcaagct gacggcgatc gccatgtgcg tcacgtcgat gatcatcctg        60
     acaggctgcg ggagcacgct gacgaggcca ggtacgggaa gtggcgcggg tgcaggtgcc       120
     ggaggcggtt cgggcggcgg cacgccgacg ccgacgccga caccgacacc aacaccaaca       180
     ccaacaccaa caccaacacc aacaccaaca ccgacaccaa cccccaccag cgccaacccc       240
     atcggcgtcg tcgtgcaaaa caccggcaac gtgatcaccg ccaccggcca aaccgtctcc       300
     gccgtcggca gccagatcgg cctcacgccg attccgggcg cgaatccggc gaccaccacg       360
     gcgctcggca acgtggtatc gaatctcggc aacggcgtga ccgccgtcgg cacaggcgtg       420
     gcgaacgggc tcggccagct tggcaattcc accaatccgc tcggcacgac gctcggcagc       480
     agtggcaacc tggtctacga cgcgggccag gccgtcaaca gcgccggcca gttggtcacg       540
     agcctcggca gcggccccac cgcgccgctg agcgcattga ccacgccgct cggcagcacg       600
     gtctcgacgg tcggcaacgc ggtcagcggc ctcggcaccc aactcggttc gcaactgacg       660
     aacggcccga tccagcaagt cacgcagacg gtctccaccg cgatcacgcc gatcacgagc       720
     acgctcgcgc agacgacgca aaccgtcggc gacacgacgg gtctcggcgc accgctaaac       780
     ggcctgcttt cgacaatcgg tcatggtctc gacagcgccg gcggcaagct cagcggcgcg       840
     accggtaatc cggtcggcca gaatctcggc aacgtcgtca ccaaactcgg cgacacggtc       900
     acgtccgcgg gcggcctgtt gacggctggc gccccgagta gcggcaatcc gctcggcggc       960
     atcacgggca ttctgaatcc gggcagcggc gcaggcacgg gctcaccgct cgcgccgttg      1020
     accagcatcc tcaccgcgct gcccggcacc ttgagcggtg gcctgacggg cggaagcggc      1080
     gccggcggcc cgctcgcacc gttgaccagt gtcgtcagca gcttgaccgg cagcctcggc      1140
     ggccttggcg gcacgggctc gggtagtccg ctcgcgccgc ttaccggcgt cgtgagttcg      1200
     gtcactggtg ccttgagcgg cgcgacgaac agcagcggca atccgcttgc gcccgtgacc      1260
     tcggccgtgt cgtcgctgac gggcgcgctg ggctcggcca caggatcggg tggcggcggc      1320
     agcaatccgc tcgcgccggt caccggtttg ctgaccaccg tcaccggcgc cttgagcggt      1380
     gcggcgacgt cggcaggcgg cacgaccggc ggcggcctgc tcggcggtct cggcgctctg      1440
     gcaatcagga agtga                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page