(data stored in ACNUC7421 zone)

EMBL: CP000270.PE139

CP000270.PE139       Location/Qualifiers
FT   CDS_pept        167182..167835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4323"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4323"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28677"
FT                   /db_xref="GOA:Q146R2"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R2"
FT                   /protein_id="ABE28677.1"
FT                   /translation="MNIPAHAPLHLLHTAAVGTLATHARQPEGFPYPSVLPFAPDPQHR
FT                   PTILVSRLAEHTHNLHADPRAGFLAVDAPDGDVLSGQRVTLLGTFEPIDPTPEVVQRYL
FT                   RYHPDAERYLVLGDFTFWAMRLERLRYIGGFGAMGWLDGAELDLLPPLAFDEENALIAQ
FT                   FAGHAEGIHLLGADRYGADLKVNGVRSRFVFDDAKLNIGNLRAALEDCMQRYAN"
     ttgaacattc ccgctcacgc cccgctgcat ctgctgcaca cggccgccgt cggcacgctc        60
     gccactcacg ctcggcagcc ggaaggcttt ccttatccgt ccgtgctgcc gtttgcaccg       120
     gacccgcagc atcgtccgac gatcctggtg agccggctcg ccgagcatac ccataacctg       180
     cacgccgacc cgcgcgccgg ttttctggca gtcgacgccc ccgacggcga cgtgctgagc       240
     ggccagcgcg tcacgctgct cggcaccttc gaaccgatcg acccgacgcc cgaggtcgtg       300
     caacgctatc tgcgctacca cccggacgcg gagcgctatc tggtgctcgg cgacttcacg       360
     ttctgggcga tgcggctcga acggctgcgc tatatcggcg gtttcggcgc aatgggatgg       420
     ctggatggcg cggaactcga tctattgccg ccactcgctt tcgatgaaga gaacgcactc       480
     atcgcccaat tcgccggcca tgccgaagga attcacctac tgggcgccga ccgatatggc       540
     gcggatctga aagtgaacgg agtgcgaagc cgttttgtct tcgacgacgc gaaactcaat       600
     atcgggaacc tgcgcgcggc gctcgaagat tgcatgcagc gctacgctaa ttag             654
//

If you have problems or comments...

PBIL Back to PBIL home page