(data stored in ACNUC7421 zone)

EMBL: CP000270.PE142

CP000270.PE142       Location/Qualifiers
FT   CDS_pept        170270..171514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4320"
FT                   /product="Cation (Co++/Zn++/Cd++) efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4320"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28680"
FT                   /db_xref="GOA:Q146Q9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q9"
FT                   /protein_id="ABE28680.1"
FT                   /translation="MPAAAAVQSAGKHRIARKTTFVSIALNAVLMTLQIVIGVFAHSQA
FT                   LVADGVHSLADLISDFVVLIANRHSGAKPDADHNYGHSRYETVASLFLGALLISVGVGM
FT                   LWRAGTRLADLQNIPAVHMSALAVAVLVLVSKESLFRYMLREAQRARSAMLIANAWHAR
FT                   SDAASSLVVAIGIVGSLAGVRLLDPIAAAIVGFMVARMGWMFGWDALQDLSDRALDDAT
FT                   TANMRALLLSTPGVRDVHEVRTRKMGDFALLDAHILVDPLISVSEGHYIAESARLRVLT
FT                   DSRVLDALIHVDPENDAVAHPPVDLPTRERVTAEVNAALAPHGMKAAAVNIHYLSAGLD
FT                   VEVVLPDTPSRAPERDVQRPGRIDLAALKARLGARRLDVLQELGTSSAGTAPAIEPKTS
FT                   TAVDYTKATEPHSAT"
     atgcctgccg ccgccgctgt ccagtccgcc ggaaaacatc gcattgcgcg caaaacgact        60
     tttgtcagta tcgcgctcaa tgccgtgttg atgacgctgc aaatcgttat cggcgtgttt       120
     gcccactccc aggcattggt cgccgacggc gtccattccc tcgccgacct catttccgat       180
     tttgtcgtat tgatcgccaa tcggcacagc ggggctaagc ccgacgcgga tcacaattat       240
     gggcatagcc gctatgaaac cgtagcgtcg ttatttctgg gtgcgctgct gatctcggtg       300
     ggcgtcggta tgttgtggcg ggccggaacg cgcctcgccg atctgcaaaa catcccggcc       360
     gtgcatatga gtgcgctcgc ggttgcggtg ctggttctgg tttccaaaga gagtctgttc       420
     cgctacatgc tgcgcgaagc gcaacgcgcg cggtcggcca tgttgatcgc caatgcgtgg       480
     catgcgcgct cggatgcggc gtcgtcgctg gtggtcgcaa tcggtattgt tggcagcctc       540
     gccggcgtgc gtctgctcga tccgattgcc gcggcgatcg tcggcttcat ggtggcgcgc       600
     atggggtgga tgttcggttg ggacgcgctg caagaccttt ccgaccgcgc gctcgacgac       660
     gccaccaccg ccaatatgcg cgcgttgctg ctctccacgc ccggcgtgcg cgacgtgcac       720
     gaagtgcgta cgcgcaagat gggcgacttc gcgctcctcg acgcgcacat tctggtcgat       780
     ccgctgatct ccgtttccga ggggcactac atcgccgagt ccgcgcgtct gcgcgtgctg       840
     acggacagcc gcgtgctcga tgcgttgatt catgtcgatc ccgagaacga cgcggttgcg       900
     cacccgcccg tcgatttgcc gactcgcgag cgggtgactg cggaggtaaa cgcagcattg       960
     gcgcctcacg gcatgaaggc ggcggcggtc aacatccact acctgagcgc ggggttggat      1020
     gtcgaggtgg tgctgccgga tacgccgtcg cgggcgccgg aaagggacgt gcaacggcct      1080
     gggcgaatcg acctcgccgc gctcaaggcg cgtctggggg ctcgcagact ggacgtgttg      1140
     caggaactgg gcacgtcgtc agccggaact gctccggcaa tcgagccaaa gaccagcacg      1200
     gccgttgact acacgaaggc tactgaacct catagcgcca cctga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page