(data stored in ACNUC7421 zone)

EMBL: CP000270.PE144

CP000270.PE144       Location/Qualifiers
FT   CDS_pept        complement(172139..172768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4318"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4318"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28682"
FT                   /db_xref="GOA:Q146Q7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q7"
FT                   /protein_id="ABE28682.1"
FT                   /translation="MSSEIYVSTDVEADGPIPGPHSMLSFASAAYTEDKRLIATFSANL
FT                   ELLEGARPHPVQEAWWKTQPEAWEACRKDLQTPVAALTAYVDWVEALPGKPVFVAMPAG
FT                   FDFTYMFWYMMRFVGRCPFSWSALDIKTLAFAMTGLPYRKNIKPRFPKHWFDEHPHTHV
FT                   ALDDAIEQGALFCNMLKDLRASQAITLAAGKDGDGTGQNPAEKPAN"
     atgagcagcg aaatctacgt gagcaccgat gtcgaagcgg acggcccgat tcccggtccg        60
     cattccatgc tcagtttcgc ctccgccgcc tacaccgaag acaagcggtt gatcgcaacc       120
     ttctcggcga atctcgaact gctcgaggga gcgcggccgc atcccgtgca ggaagcgtgg       180
     tggaagactc agcccgaagc atgggaagcc tgccgcaagg atttgcagac gcccgtggct       240
     gctttgacgg cgtacgtcga ctgggtcgaa gcgctgccgg gcaagccggt gttcgtggcg       300
     atgccggcgg gcttcgactt cacatacatg ttctggtaca tgatgcggtt tgtcggccgc       360
     tgtccgtttt cgtggtcggc gctcgacatc aagacgctgg ccttcgccat gaccgggctg       420
     ccgtaccgca agaacatcaa gccgcgcttt ccgaaacact ggttcgacga gcatccgcat       480
     acgcatgtcg cgctggatga cgccatcgaa cagggcgcgc ttttctgcaa tatgttgaag       540
     gatctacgcg ccagtcaggc gatcacgctc gcggccggta aagatgggga cggcacagga       600
     caaaaccccg ctgagaaacc ggcaaattag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page