(data stored in ACNUC7421 zone)

EMBL: CP000270.PE149

CP000270.PE149       Location/Qualifiers
FT   CDS_pept        175729..176151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4313"
FT                   /product="Protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4313"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28687"
FT                   /db_xref="GOA:Q146Q2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146Q2"
FT                   /protein_id="ABE28687.1"
FT                   /translation="MRAVAPIGAFATPDNFSAPVGSKLVGAAFEARAQEFLQRQRLRFV
FT                   ARNVACRGGEIDLVMRERDGALVFVEVRARAQRRYGGAAASIGWRKQQRIVRAAQHYLA
FT                   TRSSQLRDQPACRFDVIAFEAGRLVWLRDAFRADEV"
     gtgcgcgcgg tggcgccgat cggcgcattc gccacgccgg acaacttttc ggcgcccgtc        60
     gggtccaaac tcgtcggcgc ggccttcgag gcgcgcgcgc aggagttttt gcagcggcag       120
     cgcttgcggt tcgtcgcgcg caatgtggca tgccgcggcg gcgagatcga tctcgtgatg       180
     cgcgagcgtg acggcgcgct ggtgttcgtc gaagtgcggg cgcgcgcgca gcgccggtac       240
     ggcggcgcgg cggcgagtat cggttggcgg aagcaacagc gcatcgtgcg cgccgcgcag       300
     cattatctgg cgacccgtag ctcccagttg cgcgatcagc ccgcttgccg gttcgacgtg       360
     atcgcgttcg aagccggccg gctcgtgtgg ttgcgcgacg cgtttcgcgc cgacgaagtc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page