(data stored in ACNUC7421 zone)

EMBL: CP000270.PE151

CP000270.PE151       Location/Qualifiers
FT   CDS_pept        176983..177777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4311"
FT                   /product="periplasmic phospholipid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4311"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28689"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q0"
FT                   /protein_id="ABE28689.1"
FT                   /translation="MSVFRVKKTLVRTVLVVGFAAGLSATLQGCFLAVAGAAGGGALVA
FT                   TDRRTLGAQTEDRELQVKALSQISQNLPDNAHVNVAVFNRRVLLTGEVAGDVSKQRAET
FT                   IVRGLNNVTTIVNELAIMPASSFSSRTNDTYLETRVKTALIAEKNISANNFKVVAERGS
FT                   VYLMGLVTMDEGNRGADVASRVPGVVQVVKVFQYIQPQEAVAAAAAAGTAPVAASQPDA
FT                   GAATVGAIPDSSVSSRPLEQQAPAPVSNSNSVHPGNPKATTP"
     atgagcgtat tccgcgtcaa gaagacactg gtgagaaccg tgctggtggt agggttcgcg        60
     gcggggctgt ccgcaacatt gcagggctgc tttctcgccg ttgccggcgc ggcgggcggc       120
     ggcgcgctgg tggcgaccga ccggcgcacg ctcggcgcgc agaccgaaga tcgcgagttg       180
     caggtgaagg cgctttcgca gatcagtcag aacctgccgg acaacgcgca cgtgaacgtg       240
     gccgtgttca accgccgcgt gctgttgacg ggtgaagtgg cgggggatgt gtcgaagcaa       300
     cgtgcggaga ccatcgtgcg cggcttgaac aacgtcacta cgatcgtcaa cgaactggcg       360
     atcatgccgg cgagttcgtt ttcgtcgcgt acgaatgaca cctacctcga aacgcgtgtg       420
     aagaccgcgc tgatcgccga gaagaacatt tcggcgaaca acttcaaggt cgtggccgag       480
     cgtggctcgg tgtatctgat gggccttgtg acgatggacg aaggcaatcg cggcgcggat       540
     gtggcgagcc gcgtgccggg cgtggtgcag gtggtgaagg tgttccagta catccagccg       600
     caggaagccg tggcggcagc cgccgcagcg gggacggcac ccgtggcggc ttcgcaaccg       660
     gatgcgggcg cggcgactgt cggcgctatt cctgattcgt cggtgagttc gcggccgctg       720
     gagcagcagg cgccggcgcc ggtcagcaat tcgaactcgg tgcatccggg taatccgaag       780
     gcgacgacgc catga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page