(data stored in ACNUC7421 zone)

EMBL: CP000270.PE153

CP000270.PE153       Location/Qualifiers
FT   CDS_pept        179376..180617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4308"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28691"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P8"
FT                   /protein_id="ABE28691.1"
FT                   /translation="MKKLLPLLLVASLAACSQKPEVACNGDDAKSVVTSILKDALVKQI
FT                   TSDFAGPNSNVQVNVDGALIRATVDKIGITLDDVLTTKSDPNSTKKFCSATMRLSVPAD
FT                   VVSNADAARSMLSLNSSHQGALQAGVDFDANTVKASLEYGVQPTDDGKKIYGSTEGNNA
FT                   ALTFASTLVEESFVKTALERQKAEQAKQEQQKALQAQQQQAEIAQAQAADNEAALQKAQ
FT                   SDMKMANDAINVVWNAGSKEWRQALLPEQRLWLAQRENDCKIKALDSGTPDTTAFQTNK
FT                   LNCQVQMTVDRTQALKISLQQSLSQQSVAGTSSTSALQPTLTTSFDCSSARSDAEHIIC
FT                   SDPELAADDVELSRIFARAKAAVTDQAAFRERTRQQWNYREQSCHDRNCLVRWYADQKT
FT                   ALTQIAQTGRVDAN"
     gtgaagaagc tcctcccgtt gttgcttgta gccagcttag ccgcgtgttc acaaaaaccg        60
     gaagtcgcct gcaacggtga cgacgcaaag tctgtggtga cctcgatatt gaaagacgct       120
     ttagtgaagc agatcacttc ggactttgct gggccaaatt ccaatgtaca ggtcaacgtt       180
     gacggggcgt tgattcgggc aactgtcgac aaaatcggta tcactctcga cgacgtgctg       240
     acgacgaaga gtgatccgaa tagcaccaag aaattctgtt cagcaacgat gcggctctcg       300
     gtgccggctg atgtcgtttc caatgccgat gcggcaagaa gcatgctgtc gcttaacagc       360
     tctcatcagg gcgcattgca ggccggcgtc gatttcgatg cgaatacggt taaggcgtcg       420
     ctcgaatatg gagtccagcc gacggacgac ggcaagaaaa tctacggtag cactgagggg       480
     aataatgcgg cgcttacgtt tgcgtcaacg ttggttgaag agtcgtttgt aaagacggcg       540
     ctggaaaggc agaaggctga gcaagccaag caggaacagc aaaaggcgct gcaggcgcag       600
     caacagcaag ccgaaatcgc acaggcacaa gcagcggaca acgaggctgc ccttcaaaaa       660
     gcgcagtcgg acatgaagat ggccaacgat gccatcaacg ttgtttggaa tgccgggagc       720
     aaggagtggc ggcaagcatt gttgccagag caacgattgt ggcttgctca acgcgagaac       780
     gactgcaaga taaaagcgct cgatagcgga acgccggata ctaccgcatt tcaaacgaac       840
     aagctgaatt gtcaggtgca gatgaccgtc gatagaacgc aagcactgaa aatttcgctg       900
     cagcagagcc tgtcgcagca gtcggttgct ggaacaagct caacttccgc actacaaccc       960
     acattgacca ccagcttcga ttgttcaagc gcgcgttctg atgctgagca tattatctgt      1020
     agcgatccag aactcgcagc ggacgatgtt gagctgtcga ggatattcgc cagggcgaag      1080
     gccgccgtaa ccgatcaagc ggcattccgg gagcgtaccc gtcaacagtg gaactaccgt      1140
     gagcagagct gtcacgaccg aaactgcctg gttcgatggt acgccgacca gaagactgct      1200
     ctgacacaga ttgcacagac tggccgagta gatgcgaatt ag                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page