(data stored in ACNUC7421 zone)

EMBL: CP000270.PE170

CP000270.PE170       Location/Qualifiers
FT   CDS_pept        198939..199637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4291"
FT                   /product="Putative copper homeostasis protein CutC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4291"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28708"
FT                   /db_xref="GOA:Q146N1"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q146N1"
FT                   /protein_id="ABE28708.1"
FT                   /translation="MSALLEVIATTVADARLAAQAGANRLELVTAMGEGGLTPSLGLIE
FT                   AVVAAVEIPVNVIVRPHSRSFVYDADDYAVMLRDVRAVNAAGANGVVIGMLDAAGGIDR
FT                   EGLARAIDAADGLAITFHRAFDEARDLRESLDVLLGFDAVTNVLTSGGQPSVLHAEATI
FT                   RELVRQASGSHLTVLAGAGLTVDAIAGFVSGTQVEAVHFGSGVRVNGNGLAPVDADKVA
FT                   KVRALLDAQT"
     atgtccgctc ttctggaagt catcgccacg accgttgccg acgcgcgcct tgccgcgcaa        60
     gcgggcgcca accgtctcga actcgtcaca gcgatgggcg agggcggcct cacgccgagc       120
     ctcggcctga tcgaagccgt agtggcggcg gtcgagattc ccgtgaacgt aatcgtgcgg       180
     ccgcatagcc gttcgttcgt gtacgacgcc gacgactacg cagtgatgct gcgcgacgtg       240
     cgggcggtca acgcggcggg cgcgaacggt gtcgtgatcg gcatgctcga cgcggcaggc       300
     gggatcgacc gcgaaggtct cgcccgcgcg atcgatgcgg ccgacggatt ggccatcacc       360
     ttccatcgcg cgttcgacga ggcgcgtgat ctgcgcgaat cgctcgacgt gctgctcggt       420
     ttcgacgccg tgacgaacgt gttgacctcg ggtgggcagc catcggtact gcatgcggaa       480
     gctacgatcc gtgaactggt gcggcaagcc tccggttcgc acttgacggt gctggccggc       540
     gccggtttga cggtcgatgc gatcgccggt tttgtgagcg gcacgcaagt cgaagcggtg       600
     catttcggtt caggcgttcg ggtgaacggc aacggtctcg cgccggtgga cgccgacaag       660
     gtcgcgaagg tcagagcgct gctggacgcg cagacgtaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page