(data stored in ACNUC7421 zone)

EMBL: CP000270.PE175

CP000270.PE175       Location/Qualifiers
FT   CDS_pept        complement(205552..206469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4286"
FT                   /product="Putative carbohydrate kinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4286"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28713"
FT                   /db_xref="GOA:Q146M6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M6"
FT                   /protein_id="ABE28713.1"
FT                   /translation="MSNPGVNSEFPLFVSAGDILTDLVRTGPSQWLSRPGGAGWNVARC
FT                   VARLGLPTACAGSLGVDNFSDELWNASVAAGLDMRFMQRVERPPLLAIVHQTHPPAYFF
FT                   MGENGADLAFDPARLPAGWASHVKWAHFGCISLVRQPLGNTLAALAAQLRSQGVKISFD
FT                   PNYRNLMEHGYEPTLRKMAALADLIKVSDEDLRLLFKTDDEASALAQLRAMNPAATVLV
FT                   TRGPETAVLIDGAVVTEARPPRVEVVDTVGAGDASIGGLLFSLMTAPQRAWPEHLAFAL
FT                   AAGAAACRHAGAHAPSLDEVVALL"
     atgagcaacc ctggcgtgaa cagcgaattc cctctcttcg tctcagccgg cgacatcctc        60
     accgatctcg tgcgcaccgg cccttcccaa tggctctcgc gtcccggtgg cgccggctgg       120
     aacgtggcgc gctgcgtggc gcggctcggc ctgcccacgg catgcgccgg ctcactgggc       180
     gtcgacaatt tctccgacga actgtggaac gccagcgtcg ccgcagggct cgacatgcgc       240
     ttcatgcagc gcgtggaacg cccgcccctg ctcgcgatcg tgcatcagac gcatccgccc       300
     gcgtatttct tcatgggcga gaacggcgcc gatctggctt tcgatccggc acgcctgccg       360
     gcaggctggg cgagccacgt gaagtgggcg cacttcggct gcatcagcct cgtgcggcag       420
     ccgctcggca acacgctcgc agcgctcgcg gcgcagttgc gctcgcaagg cgtgaaaatc       480
     agtttcgatc cgaactaccg caatctgatg gagcatggct acgagcccac gttgcgaaaa       540
     atggccgcgc tcgcggatct gatcaaggta tcggacgaag acctgcgcct gctcttcaaa       600
     accgacgacg aagccagcgc gcttgcgcaa ctgcgggcca tgaaccccgc cgccaccgtg       660
     ctggtgacgc gcggaccgga gaccgccgtg ctgatcgacg gcgccgtggt gaccgaggcc       720
     cggccgccgc gcgtcgaggt cgtcgacacg gtcggcgcgg gcgacgcgtc catcggcggc       780
     ctgctgttca gcctgatgac cgcgccgcag cgggcgtggc ccgaacacct cgcgttcgcg       840
     ctggccgccg gggcggccgc gtgccgccat gccggcgcgc acgcgccgtc gctcgatgaa       900
     gtggtcgcgc tgctgtaa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page