(data stored in ACNUC7421 zone)

EMBL: CP000270.PE187

CP000270.PE187       Location/Qualifiers
FT   CDS_pept        complement(222507..223427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4274"
FT                   /product="Putative metallo-beta-lactamase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4274"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28725"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L4"
FT                   /protein_id="ABE28725.1"
FT                   /translation="MITLPESIRVFERGWLSSNNVLLLDDACAALVDTGYATHAPQTLA
FT                   LVRQALGARPLDLIVNTHLHSDHCGGNALLQATWPCRTVIPASEAGAVRDWDDTRLTFR
FT                   ATGQTCERFTFTGTIAPGAQLRLGALDWKVLGAPGHDPHSLMLYCAGERILISADALWE
FT                   NGFGVIFPELEGESGFAEEQAVLEAIAKLDVRLVIPGHGAPFTNVEQALERAFSRVAWL
FT                   RADPARNAKNALKVLIVFKLLEVRAMRFDTLLQMLDDAAVMRAAATMLKPRGEWPALVK
FT                   NIVEELAARNGPLEVDGERVVARAA"
     atgatcacgc taccggaatc gattcgggtt ttcgaacgcg gctggctttc gtcgaacaac        60
     gtgctgctgc tggacgacgc atgcgccgcg cttgtcgata ccggctacgc cacgcacgcg       120
     ccgcaaacgc tcgccctggt gcggcaggcg ctcggcgcgc ggccgctcga tctgatcgtc       180
     aacacgcatc tgcattcgga ccactgcggc ggcaatgcgc ttctgcaggc cacatggccg       240
     tgccgcaccg tgattcccgc ctcggaagcc ggtgccgtgc gcgactggga cgacacacgc       300
     ctcacgtttc gcgcgaccgg ccagacgtgc gagcgcttca ccttcaccgg cacgattgcg       360
     cccggcgcgc agttgcggct cggcgcgctc gactggaaag tgctcggcgc gcccggccac       420
     gatccgcatt cgctgatgct ctactgcgcc ggcgagcgca tcctgatcag cgcggacgcg       480
     ctttgggaaa acggtttcgg cgtgatcttt ccggaactgg aaggcgaaag cggtttcgcc       540
     gaggaacagg cggtgctcga agccattgcg aagctcgacg tacgcctcgt gatacccggc       600
     cacggcgcac ccttcacgaa tgtcgaacag gcgctggagc gcgcgttttc gcgtgttgcg       660
     tggctgcgtg ccgatccggc ccgcaacgca aagaacgcgc tgaaggtgct gatcgtgttc       720
     aagctgctcg aagtccgcgc gatgcgcttc gacactctgc tgcaaatgct cgacgacgcc       780
     gccgtgatgc gcgccgccgc gacgatgctc aagccgcgcg gcgagtggcc cgcgctggtg       840
     aaaaacatcg tcgaggaatt ggccgcgagg aacgggccgc tggaagtgga tggcgagcgc       900
     gttgtcgcgc gcgcggcatg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page