(data stored in ACNUC7421 zone)

EMBL: CP000270.PE188

CP000270.PE188       Location/Qualifiers
FT   CDS_pept        complement(223424..223903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4273"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4273"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28726"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L3"
FT                   /protein_id="ABE28726.1"
FT                   /translation="MNAAPRIVTIGETFSSTLELSAESVKSFASLVNDHNPLHHDEAYA
FT                   AQSRFGGLIASGTQPTAHFMALLATHFSTYAQPLGLEFDIKLKKAVRANDTLTITWRVK
FT                   DAYWKPSLNGDLTQLEGTVVNQRGDTMLTGSSTILVMPKSEAAANTHANAAPNSP"
     atgaacgccg cgccgcgcat cgtcacgatt ggcgagacgt tcagttcgac gctggagtta        60
     tcggcggagt cggtgaaatc gttcgcctcg ctggtgaacg accacaaccc gctgcatcac       120
     gacgaggcgt atgcggcgca aagccgcttt ggcggactga tcgcatccgg cacgcagccg       180
     accgcgcatt tcatggcgct gctggccacg catttttcga cctacgcgca accgctcggt       240
     ctcgagttcg atatcaagct gaagaaagcc gtccgcgcga atgacacgct caccatcacc       300
     tggcgcgtga aggacgctta ctggaagccg agcctgaacg gcgatctgac ccaacttgaa       360
     ggcacagtcg tgaatcagcg cggcgacacc atgttgaccg gttcgtcgac cattctcgtc       420
     atgccgaaat ctgaagccgc agcgaacaca cacgcaaacg cggcgcccaa ctcgccatga       480
//

If you have problems or comments...

PBIL Back to PBIL home page