(data stored in ACNUC7421 zone)

EMBL: CP000270.PE195

CP000270.PE195       Location/Qualifiers
FT   CDS_pept        227809..228834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4267"
FT                   /product="Putative ABC sulfate transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4267"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28733"
FT                   /db_xref="GOA:Q146K6"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K6"
FT                   /protein_id="ABE28733.1"
FT                   /translation="MAGKTGTSRWLAAGMTAMTLALAGVPAAHAETSLLNVSYDVTREL
FT                   YKDINAGFIAAYKQKSGETVSIRQSHGASSAQALSVLQGLQADVVTMNQPNDIDLLAEK
FT                   GQLLPANWRTRLPNDSVPYTTTMVFLVRKGNPKHIKDWDDLARPGVQVIIANPKTSGNG
FT                   RYTYLAAWGYRKQHGGTDAQALDFEKAIFKNVPVLDTGGRGATTTFTQRGIGDVLVTFE
FT                   NEVALMDTGVGGGNFEAVYPSVSLLAAPPVSIVDKVVDKRGTRKEAQAYLDYLWSPAAQ
FT                   EIIAQHHLRPQDKTVLAKHASEFKAIKTFTVEEMFGGWQKAQQTHFSDGGTFDQIIVDK
FT                   K"
     atggcaggca agacggggac ttcgcgctgg ctggcagccg gcatgacggc aatgacgctc        60
     gcgctggcgg gcgtgccggc agcgcacgca gagacgtcgc tgctcaacgt gtcgtacgac       120
     gtgacgcgtg agctgtacaa ggacatcaac gctggcttca ttgccgcgta caagcagaag       180
     agcggcgaga ccgtctcgat ccgccagtcg catggcgcgt cgagcgcgca ggcgctgtcg       240
     gtgctgcaag gcttgcaggc cgacgtggtg acgatgaacc agccgaacga catcgacctg       300
     ctcgccgaga aaggtcaact gctgccggcc aactggcgca cgcgtctgcc gaacgacagc       360
     gtgccctaca ccaccacgat ggtgttcctc gtgcgcaagg gcaacccgaa gcacatcaag       420
     gactgggacg atctcgcgag gccaggcgtg caggtgatca tcgccaatcc gaagacatcg       480
     ggtaacgggc gctatacgta tctggccgcg tggggttatc gcaagcagca cggcgggacc       540
     gacgcgcagg cgctcgactt cgaaaaggcg atcttcaaaa acgtgccggt gctcgacacg       600
     ggcggccgcg gcgcgacgac cacgtttacg caacgcggta tcggcgacgt gctggtgacg       660
     ttcgaaaacg aagtggcgct gatggacacg ggcgtgggcg ggggcaactt cgaggcggtg       720
     tatccgtccg tgagtttgct ggcggcgccg ccggtttcga tcgtcgacaa ggtggtcgac       780
     aagcgcggca cgcgcaagga agcgcaggcg tatctcgact atctgtggtc gccggccgcg       840
     caggagatca tcgcgcagca tcacttgcgt ccgcaggaca agaccgtgct cgcgaagcat       900
     gcgtcggagt tcaaggcgat caaaaccttc actgtcgaag agatgttcgg tggctggcag       960
     aaagcgcagc aaacgcattt ctccgatggc gggacattcg atcagatcat cgtcgacaag      1020
     aagtaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page