(data stored in ACNUC7421 zone)

EMBL: CP000270.PE2

CP000270.PE2         Location/Qualifiers
FT   CDS_pept        2047..3150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4461"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4461"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28540"
FT                   /db_xref="GOA:Q147E9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E9"
FT                   /protein_id="ABE28540.1"
FT                   /translation="MQLVKTERDNLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGGDSVATTVAARKLLDILRAMPDGQVTLTLNDKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQAKDYGANLVVPQKTFRQLLGMVHFSMAQQDIRYYLNGMLLVV
FT                   DGDQLMAVATDGHRLAFSSMKIEGSFQRQEVIIPRKTILELQRLLEDIDDTLKIDIAQT
FT                   QVKFTFGQVELVSKLVEGKFPDFQRVIPKSHKNQFVIGREELQRSLQRAAILTSDKFKG
FT                   VRCIIEPGQLKIMSTNADQEEAQEELEIAYDGDSVDIGFNVTYLLDVLANLKVDTLQVS
FT                   LGDASSSALITIPENDEFKYVVMPMRI"
     atgcaactgg tcaagaccga acgcgataac ctcctcaggc cgctgcaaac tgtgagcggc        60
     atcgtcgaac gccgccatac gttgccgatc ctcgccaatt tgctgattac caagaacggc       120
     ccggacgtgt cgttcctgtc caccgacctc gagttgcaga tcaccacgcg tgccgatttc       180
     ggcgtgggcg gcgattcggt ggcgaccacg gtggcagcga gaaagctcct cgacattctg       240
     cgcgccatgc ccgacggcca ggtcacgctc acgctgaacg acaagcgtct gaccgtgcaa       300
     tccggcaaga gccgctttgc gctgcaaacg ctcgccgcgg acgaattccc gacggtcgcg       360
     caagctaaag actacggcgc gaacctcgtg gttccccaga agacgttccg ccagttgctc       420
     ggcatggtcc atttttcgat ggcccagcag gacatccgct actacctgaa cggcatgctg       480
     ctggtagtgg acggcgacca gctgatggcg gtcgcgaccg acggacaccg tctggcgttc       540
     tcgtccatga agatcgaagg ttcgttccag cgtcaggaag tgatcattcc gcgcaagacg       600
     attctggaac tccagcgtct gctggaagac atcgacgaca cgctgaagat cgacatcgcg       660
     cagacgcagg tcaagttcac gttcggccag gtcgaactgg tgtcgaagct ggtggaaggc       720
     aaattccccg acttccagcg cgtgattccg aagtcgcaca agaatcagtt cgtgatcggc       780
     cgtgaagaac tgcagcgctc gctgcaacgc gccgcgattc tgacctcgga caaattcaag       840
     ggcgtgcgct gcatcatcga gccgggccag ttgaagatca tgtcgaccaa cgccgatcag       900
     gaagaggcgc aggaagaact ggaaatcgca tacgacggcg acagcgtcga tatcgggttc       960
     aacgtcacgt atctgctcga cgtgctcgcg aacctgaagg tcgacacgtt gcaggtgagc      1020
     ctgggcgacg ccagctccag cgcgttgatc acgattcccg agaacgacga attcaagtac      1080
     gtcgtcatgc cgatgcgcat ctaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page