(data stored in ACNUC7421 zone)

EMBL: CP000270.PE200

CP000270.PE200       Location/Qualifiers
FT   CDS_pept        233584..234330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4262"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28738"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K1"
FT                   /protein_id="ABE28738.1"
FT                   /translation="MGFTGGNWGGGWFFVCAGLCVCVPGGLAFPCIHGGLLALPLCGAA
FT                   PTFFAAAKKVGKESRFTPPTLKRVPWLGGDSGASGICVVAHSALVTRPSYFPPRTACSP
FT                   ERSGKTSVVRVWGVGFGSAWRRKVSRACVQTAHRTTAVMEAPSANSRGRQRLRRLSRKE
FT                   QAATLKARFAPVATGEQRDIARARGNQRFEKRRAQEVSGKISPVREATTGFNELPRRRA
FT                   QRRRKNDGLVTKAECATTQIPDGPLP"
     ttgggtttta ctggcgggaa ttggggtggg gggtggtttt ttgtctgtgc agggctttgt        60
     gtctgtgttc ctgggggctt ggcctttcct tgcattcacg gtggtctgtt agcgttgccc       120
     ctgtgcgggg cggcacctac tttctttgcc gcggcaaaga aagtaggcaa agaaagccgc       180
     tttacaccgc caactcttaa gcgggtcccc tggcttggag gggatagtgg tgcatctgga       240
     atctgtgtcg tcgcgcattc agccttggtg acaaggccgt catacttccc gcctcgcact       300
     gcgtgctcgc cggaacggtc cggtaaaacc agtgttgtgc gtgtgtgggg cgtcggcttt       360
     ggctctgcgt ggcgccgaaa agtgtcgcga gcttgtgtgc agacggcaca cagaacgacg       420
     gcggtgatgg aggcgccgtc cgctaactca agaggccgcc agcggttgag aagactgtcg       480
     cgcaaggaac aggcagcaac cctaaaggcc cggttcgcgc ccgtcgcgac tggcgagcag       540
     agagatatcg cccgcgcgcg aggcaatcag cgatttgaga aacggcgcgc gcaagaagtg       600
     tcggggaaga tatcgcccgt acgagaagcg accactggtt ttaacgaact accgcgacgg       660
     cgcgcgcagc gtcgccggaa gaatgacggc cttgtcacca aggctgaatg cgcgacgaca       720
     cagattccag atggtccact accgtga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page