(data stored in ACNUC7421 zone)

EMBL: CP000270.PE203

CP000270.PE203       Location/Qualifiers
FT   CDS_pept        237370..237660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4259"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28741"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J8"
FT                   /protein_id="ABE28741.1"
FT                   /translation="MPGRASCAICGVGMNRLSQRDVMKLRPYPGTTILFCAIKENPRRK
FT                   ICRAPICRLRPLDAGLAGVWCNEAIRRGAGVVASSQHEKMALLSGPYVSAA"
     gtgcccggca gggcgtcctg cgcaatttgc ggagttggta tgaatcggct ctcgcaacgt        60
     gacgtcatga agctacggcc ttatcctggc acgacaattt tgttttgtgc aatcaaggag       120
     aacccgcgac gcaaaatttg ccgcgcgccg atttgccgcc tgcggccgct cgatgcaggc       180
     ctcgcgggtg tttggtgcaa cgaagcaatc aggcgcggcg cgggcgttgt ggcatcgagc       240
     caacatgaaa aaatggccct gctatcaggg ccatatgtga gcgcggcgta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page