(data stored in ACNUC7421 zone)

EMBL: CP000270.PE213

CP000270.PE213       Location/Qualifiers
FT   CDS_pept        complement(247755..248573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4249"
FT                   /product="Putative ABC Fe+3/siderophore transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4249"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28751"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I8"
FT                   /protein_id="ABE28751.1"
FT                   /translation="MQPGAVDAAGVAHEPAGPAARIVSLVPSITELLFALGLDRQIVGR
FT                   TGFCVHPHDKARQVRKVGGTKAVNPDAIRALRPTHLIVNIDENERDTVEQLRGFVPHIV
FT                   VTHPQTPRDNLALYTLLGAIFDRAREAERLGEALEARLHEAAAHAFTPQNVLYLIWREP
FT                   WMTVARDTYISAMLRLVNWHTLPDVQGGTAGAGRYPALDFDSAPWLARVERVLLSSEPY
FT                   RFTQTHCDALKRDARLAGKRIELIDGEMVSWYGVRAIEGIAYLLRRAAAA"
     atgcaaccgg gtgcggtcga tgcagccggc gtcgcgcacg aacccgcagg acccgcggca        60
     cgtatcgtct cgctggtgcc gagcatcacc gaactgctgt tcgcgctcgg tctggaccgg       120
     cagattgtcg gccgcacggg tttctgcgtg catccgcacg acaaggcgcg ccaggtccgc       180
     aaggtcggcg gcaccaaggc cgtgaatccc gacgccattc gcgcgttgcg ccccacccat       240
     ctgatcgtca atatcgacga aaacgagcgc gataccgtcg agcaattgcg cgggttcgtg       300
     ccgcatatcg tcgtgacgca tccgcagaca ccgcgggaca atctggcgct ctacacgctg       360
     ctgggcgcga tcttcgatcg cgcgcgggaa gcggagcgtc tgggcgaagc gctcgaagcc       420
     cgtctgcacg aggcggccgc gcacgcgttc acgccgcaaa acgtgctgta tctgatctgg       480
     cgcgagccct ggatgaccgt ggcgcgcgat acttatatct ccgcgatgct gaggctcgtg       540
     aactggcaca cgctgcccga tgtgcaaggc ggtacggcag gcgccggacg ctacccggcg       600
     ctcgacttcg acagcgcgcc gtggctcgcc cgtgtcgagc gcgtcctgct ctccagcgag       660
     ccgtatcgct ttacgcagac ccattgcgac gcactgaagc gcgatgcgcg gctggccggc       720
     aagcgcatcg agctgatcga cggggaaatg gtgtcgtggt acggcgtgcg cgcgatcgaa       780
     ggcattgcgt acctgctgcg gcgcgccgcg gcggcatga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page