(data stored in ACNUC7421 zone)

EMBL: CP000270.PE216

CP000270.PE216       Location/Qualifiers
FT   CDS_pept        complement(250182..250979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4246"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4246"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28754"
FT                   /db_xref="GOA:Q146I5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I5"
FT                   /protein_id="ABE28754.1"
FT                   /translation="MAKPRRTTKQSKQTGGTFLGIVLGLIVGLAIAVVVALYITRAPTP
FT                   FVSKVAPPAASDSGASQPQYDPNRPLQGKTPGQPVPQAAQPAPPNTAPGQTNAQTQSGM
FT                   LEEPQIVEVPPANGNAGNANGTAVAPKPAQDNGTGTAAAPVKKPQAASAPAATAAGAAP
FT                   KGGSSTAANARPGSGAAPAAGDANTGYFLQVGAYKTAADAEQQRARLAFQGFESKVTQR
FT                   DAGGVTYYRVRIGPFSKFEDMNSSRQRLSDAGVDTAVIRFTKQ"
     atggcaaaac cacgccgcac aacaaagcaa tcgaaacaaa ccggggggac ttttctcggc        60
     atcgtgctgg gcctgatcgt cggccttgcg atcgcggtag tggtggcgct gtatatcacc       120
     cgtgcgccca cgccattcgt ctcgaaggtg gcgccgcccg cggcgtccga ttccggcgcg       180
     agccagccgc agtacgaccc gaaccgtccg ctgcaaggca agacgccggg tcagccggtg       240
     ccgcaggccg cgcagccggc gccgccgaac accgcgccgg gccagaccaa cgcgcagacg       300
     cagtcgggca tgctggaaga gccgcagatc gtcgaagtgc cgcccgccaa cggcaacgcc       360
     ggcaacgcga acggcacggc agtcgcgccg aagcccgcgc aggacaacgg caccggcacg       420
     gccgccgcgc cggtgaagaa gccgcaagcc gcaagcgcgc cggccgccac cgcggcgggc       480
     gcggcgccta agggcggttc gtccaccgcc gccaacgcca ggcccggttc gggcgcggcg       540
     ccggcagcgg gcgacgcgaa caccggctac ttcctgcaag tcggcgcgta caagaccgcg       600
     gcggacgccg aacagcagcg cgcgcgtctc gccttccagg gcttcgaatc gaaggtcacg       660
     cagcgcgacg ccggcggcgt cacgtattac cgcgtccgca tcgggccgtt ctcgaagttc       720
     gaagacatga attcgagccg ccagcgtctg tccgacgcgg gcgtggacac cgcggtgatc       780
     cgcttcacga aacaataa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page