(data stored in ACNUC7421 zone)

EMBL: CP000270.PE231

CP000270.PE231       Location/Qualifiers
FT   CDS_pept        268434..268790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4231"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28769"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H0"
FT                   /protein_id="ABE28769.1"
FT                   /translation="MKHGGATCGPGAVCQGEFASVMVLTPIFETLRESRIFLRKVSQAL
FT                   ELRLLRCGFRQVSVLSLCKLHCFWACVENNQSNRPCSIRRRHDRRRAGRCGFHRKLARP
FT                   QARVSLTHGWPRSA"
     atgaaacacg gtggcgcgac ttgcggcccc ggcgccgtgt gccaaggcga attcgcatct        60
     gtcatggttt tgacgccgat cttcgagaca ctccgcgaat ctcgcatttt cttgcggaag       120
     gtcagccagg cactggaatt gcgcctgtta cggtgcgggt tccgtcaggt cagcgtgcta       180
     tcattgtgta agcttcactg cttttgggcg tgcgttgaaa acaatcaatc caaccgccct       240
     tgctccattc gccgccggca cgatcggcgc agggctggac ggtgcggttt tcatcgcaaa       300
     ctggctcgac ctcaggcacg ggtatccctc acccacggtt ggccgcgcag cgcgtaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page