(data stored in ACNUC7421 zone)

EMBL: CP000270.PE234

CP000270.PE234       Location/Qualifiers
FT   CDS_pept        complement(270601..270840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4228"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4228"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28772"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G7"
FT                   /protein_id="ABE28772.1"
FT                   /translation="MLRWLIAILFLANMLAFVAVRGVFGPTPTAGGREPNHLNRQVHPE
FT                   WLKVQPVTAAEAADQAVVGGPAPVAPIAASALAQ"
     atgctgcgct ggctgatcgc catactgttt cttgccaaca tgctggcatt cgtcgcggtg        60
     cgcggcgtat tcggcccgac gcccacagcc ggcggacgcg agcccaacca tctgaaccgc       120
     caggttcatc cggaatggtt gaaagtgcaa ccggtcacgg cagcggaggc cgccgatcag       180
     gcggtggtgg gtggaccggc accggtggcg ccgatcgcgg catccgcgct ggcgcagtaa       240
//

If you have problems or comments...

PBIL Back to PBIL home page