(data stored in ACNUC7421 zone)

EMBL: CP000270.PE243

CP000270.PE243       Location/Qualifiers
FT   CDS_pept        278139..278783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4219"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4219"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28781"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F8"
FT                   /protein_id="ABE28781.1"
FT                   /translation="MNAYTKKYLIDGPVGKIEVAVDLPDETRESGAAPRGIALVAHPHP
FT                   LFGGTMDNKVAQTLARTLVQLNYATYRSNFRGVGETQGEHDAGIGERDDLRAVLDHMRA
FT                   EPGQADLPLVLAGFSFGTFVLSHVAATLREEGQEIERMVFVGTAASRWDVAPVPENTIV
FT                   IHGETDETVPIQSVYDWARPQELPVVVIPGAEHFLHRKLHVLKRIIVDAWR"
     atgaatgcct atacgaagaa atatctgatc gacggcccgg tcggcaagat cgaggtcgcg        60
     gtggatctgc ccgacgagac gcgcgaaagc ggtgccgcgc cgcgtggcat cgcgctggtc       120
     gcgcatccgc atccgctgtt cggcggcacg atggacaaca aggtcgcgca gacgctcgcg       180
     cgcacgctcg tgcagttgaa ctacgcgacc tatcgctcga attttcgcgg tgtcggcgag       240
     acgcaggggg agcatgacgc gggcatcggc gagcgcgacg atctgcgcgc cgtgctcgat       300
     cacatgcggg ccgaaccggg tcaggccgat ctgcccctcg tgctggcggg gttttcattc       360
     ggcacgttcg tgctgtcgca tgtggccgcg acactgcgtg aagaaggtca ggagatcgag       420
     cgaatggtgt tcgtcggcac tgcggcgagc cgctgggacg tggcccccgt accggagaac       480
     acgatcgtga ttcacggtga aaccgacgag acggttccca ttcaatccgt ttacgactgg       540
     gcgcggccgc aggaattgcc ggttgtcgtg attccggggg cggagcattt tctgcatcgc       600
     aagctgcacg ttctgaagcg gatcatcgtc gacgcgtggc ggtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page