(data stored in ACNUC7421 zone)

EMBL: CP000270.PE248

CP000270.PE248       Location/Qualifiers
FT   CDS_pept        282642..282968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4214"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4214"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28786"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F3"
FT                   /protein_id="ABE28786.1"
FT                   /translation="MREISSSIAFEIRNGETVPLKVARSTRLVVRGGAIWVTRSDDTED
FT                   YWLQPGHTLRLRRGERLWLSAEGDTQARVAFSVPTRCDERALNWFARIGERLVARVRGG
FT                   WRTV"
     atgcgagaaa tttcctctag catcgcgttt gaaatccgca acggcgaaac ggttcccctg        60
     aaggtggcgc gcagcacgag actggtggtt cgcggcggtg cgatctgggt cacgcgtagc       120
     gacgacacgg aggactactg gctgcagccc ggtcatacgc tgcggcttcg gcgcggcgaa       180
     cggctgtggc tgagcgccga gggcgacacg caggcaagag tggcgttttc agtgccgacg       240
     cgctgcgacg agcgcgcgct gaactggttc gcgcggatcg gcgaacggct ggtggcgcgt       300
     gtacggggcg gctggcgtac cgtttga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page