(data stored in ACNUC7421 zone)

EMBL: CP000270.PE249

CP000270.PE249       Location/Qualifiers
FT   CDS_pept        283228..283953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4213"
FT                   /product="Lipoate-protein ligase B"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4213"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28787"
FT                   /db_xref="GOA:Q146F2"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146F2"
FT                   /protein_id="ABE28787.1"
FT                   /translation="MCATPVSPTPLPATAPLALRWRGTEPYEASFEAMRAFTDGRTAET
FT                   PDEIWLVEHPPVFTLGQAGDPAHLLAADSGIPLVKVDRGGQITYHGPGQVVAYLLLDLR
FT                   RRKLMVRELVTRIEQAVIDTLAAYNLAGERKAGAPGIYVAPGPAAGSHAGAKIAALGLK
FT                   IRNGCSYHGVSLNVNMDLRPFLAINPCGYAGLETVDMATLGVTAGWNDVARTFAACLTA
FT                   NLDGSPAAVAQPQAGALTA"
     atgtgcgcca ccccggtttc tccgactccc ttacccgcaa cggcaccgct cgcgctgcgc        60
     tggcgtggca ccgaacccta cgaagccagt ttcgaagcca tgcgcgcgtt caccgacggg       120
     cgcaccgccg agactcccga cgaaatctgg ctggtcgaac atcctcccgt tttcacgcta       180
     ggccaggccg gcgacccagc gcacctgctg gcggctgaca gcggtattcc tctggttaaa       240
     gtcgaccgcg gcgggcagat tacgtatcac ggccccggcc aggtggttgc ctacctgctg       300
     ctcgatttgc gccgtcgcaa attgatggtg cgcgagctgg ttacgcggat cgagcaagcc       360
     gtgatcgaca cgcttgcggc gtataatctc gccggagaac gaaaggcggg cgcccccggt       420
     atctatgtgg cgcccgggcc ggccgccggg tcgcacgccg gcgccaagat cgcggcgctg       480
     ggtttgaaaa tccgcaacgg ctgcagctat cacggcgtga gtctgaacgt gaacatggat       540
     ttgcggccgt ttctcgccat caatccatgc ggctacgcgg ggctcgaaac agtcgatatg       600
     gcaacgctag gcgttaccgc cggctggaac gacgtggccc gtacctttgc agcatgtctc       660
     accgcaaacc tcgacggcag tcccgcggcc gtcgcccaac cgcaggccgg tgcacttacc       720
     gcctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page