(data stored in ACNUC7421 zone)

EMBL: CP000270.PE251

CP000270.PE251       Location/Qualifiers
FT   CDS_pept        285014..285259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4211"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28789"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F0"
FT                   /protein_id="ABE28789.1"
FT                   /translation="MLQAFLFGRPNIERWNHTRLIRICESPVIPCEQHADRGHRSADDG
FT                   KRNGEFDDAITQLTILHDVVDQIGHLSSPCWTCLKV"
     gtgttgcagg cttttctctt tgggcggcca aacattgagc gctggaatca cacgcggttg        60
     atccgcatct gcgagtcacc ggtaataccg tgcgagcagc atgcagatcg aggccatcgt       120
     tccgccgatg atggaaaaag gaatggtgag ttcgatgatg cgataacgca gctcacgatt       180
     ctccatgatg tggtcgatca gattgggcat ttgagttctc cctgttggac gtgcttaaaa       240
     gtatag                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page