(data stored in ACNUC7421 zone)

EMBL: CP000270.PE263

CP000270.PE263       Location/Qualifiers
FT   CDS_pept        295912..296703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4199"
FT                   /product="ABC spermidine/putrescine transporter,
FT                   innermembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4199"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28801"
FT                   /db_xref="GOA:Q146D8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D8"
FT                   /protein_id="ABE28801.1"
FT                   /translation="MKSQSRVGAWTAMIVGSLYFLIPLIATFEFSLRMKRGAYSFEAYS
FT                   VVLGDPRFQASFGYSILMALLTIVVGVLLVVPTAYWVQLRLPKLRPVVEFITLLPLVVP
FT                   AIVIVFGYLRIYNSSSILPLTGNERATDLLLVFGYVTLSLPYMYRAVDAGLRAVDVRSL
FT                   TEAAECLGASWPTILFKVIFPNIRSGILSGAFLTFAVVIGEFTLASLLDRPAFGPYLQL
FT                   IGANRAYEPSALAIIAFVITWASMGLIQVFGSARAMSGQKV"
     atgaagagcc aatcgcgcgt gggtgcgtgg accgcgatga tcgtcggttc gctgtacttt        60
     ctgattccgt tgatcgcgac gttcgagttc agcttgcgca tgaagcgcgg cgcgtacagc       120
     ttcgaagcgt atagcgtcgt gctcggcgat ccgcgctttc aggcctcgtt cggctattcg       180
     atcctgatgg cgctgctgac gatcgtggtc ggcgtgctgc tggtggtgcc gaccgcttac       240
     tgggtgcagt tgcgtttgcc gaagctgcgg ccggtggtcg agttcatcac gctgttgccg       300
     ctggtggtgc cggctatcgt gatcgtgttc ggctacctgc gcatctataa cagcagctcg       360
     attctgccgc tcaccggcaa cgagcgcgcc acggatctgt tgctggtgtt cggctacgtg       420
     acgctttcgc tgccgtacat gtaccgcgcg gtcgatgccg gcctgcgcgc ggtcgatgtg       480
     cgttcgctca ccgaagcggc cgaatgtctc ggcgcgagct ggccgaccat tctcttcaag       540
     gtgatctttc cgaatatccg ttcgggcatt ctgtccggcg cgtttctcac ctttgcggtg       600
     gtgatcggcg aattcacgct ggcgagcctg ctcgaccggc ctgcgttcgg tccgtatctg       660
     caattgatcg gcgcgaaccg cgcgtatgaa ccgtcggcgc tcgcgatcat tgcgttcgtg       720
     attacgtggg cgtcgatggg gctgattcag gtattcggct cggcccgtgc aatgagcggc       780
     cagaaagttt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page