(data stored in ACNUC7421 zone)

EMBL: CP000270.PE264

CP000270.PE264       Location/Qualifiers
FT   CDS_pept        296750..297820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4198"
FT                   /product="ABC spermidine/putrescine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4198"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28802"
FT                   /db_xref="GOA:Q146D7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D7"
FT                   /protein_id="ABE28802.1"
FT                   /translation="MAFLEIENLHKSFGANTALHHFDMKIERGEFITFLGPSGCGKTTV
FT                   LRMIAGFETPTRGVIRLDNKDVTHLRTRQRKVGMVFQSYALFPNMTVAENIGFGLKITH
FT                   RPQAEINQRVEEMLQLIKLPQLGGRYPWQLSGGQQQRVALARALAGKPQVLLLDEPLSA
FT                   LDAKIRISLRQDIRALQRELGITSIFVTHDQEEALSISDRIVVMNEGRVEQIGSPSEIY
FT                   NYPRTRFVASFVGTLNILAGHVVDPATGRMVVDGQELTTTQELPSNDAGKKRLLALRPE
FT                   AIVLEPAAPGRNTLNATVEEVNFLGAVVRIRTRVKDAVISLDVFNDPNRGLPERGQPVS
FT                   LGFSHENLLVLEEGGV"
     atggcattcc ttgagatcga aaatctgcat aagtccttcg gggcgaacac ggcgctgcat        60
     cacttcgata tgaagatcga acgcggcgag ttcattactt tcctcgggcc gtccggctgc       120
     ggcaagacga cggtgctgcg catgatcgcc ggcttcgaaa cgccgacgcg cggcgtcatc       180
     cggctggaca acaaggacgt tacccacctt cgcacgcggc agcgcaaggt cggcatggtg       240
     ttccagtcgt atgcgctgtt tccgaacatg acggtggccg agaacatcgg cttcgggctg       300
     aagatcacgc atcggccgca ggcggagatc aatcagcgcg tcgaggagat gctgcaactg       360
     atcaagctgc cgcaactggg cgggcgttat ccgtggcaat tgtcgggcgg ccagcagcag       420
     cgcgtggcgc tcgcgcgcgc gctcgccggc aagccgcagg tgctgctgct cgacgaaccg       480
     ctttccgcgc tcgacgccaa gatccgcatt tcgttgcgtc aggacattcg cgcgttgcaa       540
     cgcgaactcg gtatcacgtc gattttcgtc acgcacgatc aggaagaggc gctgtcgatt       600
     tccgaccgca tcgtcgtgat gaacgagggc cgcgtcgagc agatcggctc gccctccgag       660
     atctataact atccgcgcac gcggttcgtc gcgtcgttcg tcggcacgct gaatattctg       720
     gccggtcatg tggtcgatcc ggcaaccggc aggatggtgg tggacggtca ggagttgacc       780
     accacgcagg agttgccgtc gaacgacgcc ggcaagaagc gcctgctcgc gctgcggccc       840
     gaggcgatcg tgctggagcc ggccgcgccc ggccgcaaca cgctgaacgc gaccgtcgaa       900
     gaagtgaatt tcctcggcgc cgtggtgcgt atcagaacgc gcgtgaaaga cgcggtgatt       960
     tcgctcgacg tgttcaacga cccgaatcgc ggtttgcccg aacgcgggca gccggtctcg      1020
     ctgggtttct cgcacgagaa tctgctggtg ctcgaagaag gcggcgttta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page