(data stored in ACNUC7421 zone)

EMBL: CP000270.PE266

CP000270.PE266       Location/Qualifiers
FT   CDS_pept        299563..301563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4196"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4196"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28804"
FT                   /db_xref="GOA:Q146D5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D5"
FT                   /protein_id="ABE28804.1"
FT                   /translation="MKPVSARRTSVPSADEACADGTSPYATINDPHRSDIANVTRRLLI
FT                   LFALVAGLVAACGLTYSIAWQSGIDHLRRNAAVRVDRTTSALKSTLERYESLPYLLAEH
FT                   PIVQDVLVDPSAANVARANLYLEDLNRHARATVTYIIPLDGFCVAASNWRGPGSFIGAG
FT                   YQFRPYFLDAVKGGVGRFFGIGTISQAPGYYISQPVRRDGRIVGVAVVKLDLEWFQGAD
FT                   ASEPLVVTDDHGVIFLSSIPAWKYHTIRPLSGPVADSIYQARQYAQQPIPPLPVSIERT
FT                   LEGNAQIVRIGGGRYAPRYLASRRGMGEPDWHLITMSPVDPVDADARKATIVTGFGYVS
FT                   LVLLAFYWRMRRARVREVMRSRALLQKAYAELNRRVAERTADLSQANEQLQKEVAERTR
FT                   AEQELRAAHDELIQASKLAALGQMAAGITHELNQPLAALRGFSDNTRVLLERGDQVSAR
FT                   ENLEAIAALTERMGKITNQLKLFVGRARPRSARAPIVRALRNVVALLQKRLQGVEVELV
FT                   LFDAQSGTRAPLSLADDHPELVAHCDDLRLEQVLINLLGNALDATADINSPRISIEIEV
FT                   ADANLSFAVSDNGPGIADDVLPRLFEPFFTTKEMGQGLGLGLAISSSIARDCGGSLVAR
FT                   NAPGGGALFVLTLRRARVQTSHTPDPLTTGS"
     atgaaaccgg tgtccgcgcg ccgaacctcc gtgccgtcgg ccgacgaagc ttgcgccgac        60
     ggcacgtcgc cttatgccac aataaacgat cctcaccgat cggatattgc caacgtgacg       120
     cgccgcctgc tgatcctctt cgcgctcgtc gccgggctcg tggcagcgtg cgggctcacg       180
     tacagcatcg cgtggcaaag cggcatcgac catttgcggc gcaacgccgc ggtgcgagtc       240
     gaccgtacca cgagcgcgct gaagagcacg ctcgaacgct acgaatcgct gccttatctg       300
     ctggcggaac accctatcgt gcaggacgtg ctggtcgatc ccagtgcggc caatgtcgcg       360
     cgcgccaatc tttatctcga agacctgaac cgccacgcgc gcgccaccgt cacgtacatc       420
     attccgctcg acggcttttg cgttgcggcg agcaactggc gcgggccggg cagcttcatc       480
     ggtgccggct accagttccg gccgtatttt ctcgacgcgg tcaaaggcgg cgtgggccgc       540
     ttcttcggca ttggtacgat ttcgcaggcg ccgggctact acatctcgca gccggtgcgg       600
     cgcgacggca ggattgtcgg cgtggcggtc gtcaaactcg atctcgaatg gtttcagggc       660
     gcggatgcgt ccgagccgct cgtcgtgacc gacgaccacg gcgtgatttt tctgtcgtcg       720
     ataccggcgt ggaaatacca cacgatccgg ccgctgtcgg ggccggtcgc cgattccatc       780
     taccaggcgc gtcaatacgc gcagcagccg attccgccgc tgccggtgtc gatcgaacgc       840
     acgctcgaag gcaacgcgca gatcgtgcgc attggcggcg gccgctatgc gccacgctat       900
     ctcgcgtcgc ggcgcggcat gggtgagccg gactggcatc tgatcaccat gtcgcccgtc       960
     gatccggtcg acgccgacgc gcgcaaggcg accatcgtca ccgggttcgg ctacgtatcg      1020
     ctggtgttgc tcgcgttcta ctggagaatg cgccgtgctc gcgtacgcga agtaatgcgc      1080
     agccgcgcgc tgctgcaaaa ggcgtacgcc gaactgaacc ggcgcgtcgc cgagcgcacc      1140
     gcggatctct cgcaggcgaa cgaacagttg cagaaagaag tggccgaacg cacgcgcgcc      1200
     gaacaggagt tgcgcgccgc gcatgatgaa ctgatccagg cgagcaagct cgccgcgctc      1260
     ggtcagatgg cggccggcat tacgcatgaa ctgaatcagc cgctcgccgc gttgcgcggt      1320
     ttctcggaca acacacgcgt gctgctcgaa cgcggcgacc aggtgtcggc gcgcgaaaat      1380
     ctcgaagcga tcgcggcgct cactgagcgc atgggcaaga tcaccaatca gctgaaactg      1440
     ttcgtcgggc gggcgcggcc gcgcagtgcg cgtgcgccga tcgtgcgggc gttgcgtaac      1500
     gtcgtcgcgc tgctgcaaaa gcgcttgcag ggcgtcgagg tcgaactcgt cctgttcgat      1560
     gcgcaaagcg gcacgcgtgc gccgctgagt ctcgccgacg accatcccga actggtcgcg      1620
     cattgcgacg atctgcgcct cgaacaggtg ctgatcaacc tgctcggcaa cgcgctcgat      1680
     gcgactgccg acatcaactc gccgcgcatt tcgatcgaga tcgaagtcgc cgacgcgaac      1740
     ctgtcgttcg ccgtcagcga caacggcccc ggtattgccg acgacgtcct gccgcgcctg      1800
     ttcgagccgt tcttcaccac caaggaaatg ggccaggggc tgggactcgg gctggcgata      1860
     tcgtcttcga tcgcgcgcga ttgcggcggc tcgctcgtgg cgcgcaacgc gccgggcggc      1920
     ggtgcattat tcgtgttgac gctgcgccgc gcgcgcgtgc agacgagcca cacaccggac      1980
     ccgctgacaa cgggctcctg a                                                2001
//

If you have problems or comments...

PBIL Back to PBIL home page