(data stored in ACNUC7421 zone)

EMBL: CP000270.PE269

CP000270.PE269       Location/Qualifiers
FT   CDS_pept        303838..304446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4193"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4193"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28807"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D2"
FT                   /protein_id="ABE28807.1"
FT                   /translation="MTGGSPSPVSVRFAPGAVSRQSKARAAVSALACALALGGALSACS
FT                   PTFDWRTIMNNDNGYTVDLPAKPGNDQRAVQIYGKPMQMAMQTAEAGDAVFAVGTVMLP
FT                   DDSEATQRAALDFLRTGLARNVGAAPEARAVQIPLAAGGQVLGLEMKLSGEAGSQHEAR
FT                   TVYARLVAHGRHVYQAAIISPKPMQQEQVDQFFSSFQLY"
     atgaccggcg gttccccgag cccggtttct gtccggtttg cgcccggcgc cgtttcccgg        60
     cagtcgaagg cgcgtgcagc agtgagcgcg ctggcttgcg ccctggcgtt aggcggcgcg       120
     ctgagcgcat gctcgccgac cttcgactgg cgcaccatca tgaacaacga caacggctac       180
     accgtcgacc tgcccgcgaa gccgggcaat gatcagcggg ccgtgcagat atacggcaag       240
     ccgatgcaga tggcgatgca gacggctgaa gccggcgacg ccgtgttcgc ggtcggcacg       300
     gtgatgctgc cggacgacag cgaagccacg cagcgcgccg cgctcgactt cctgcgcacc       360
     ggccttgccc gcaacgtagg cgctgctccg gaggcccgcg cggtgcagat cccgcttgcc       420
     gccggcggtc aggtgctcgg cctggaaatg aagctgagcg gcgaggccgg atcgcagcac       480
     gaagcacgca cggtctacgc ccggctcgtg gcgcacggac ggcatgtcta tcaggcggcc       540
     atcatttcac ccaagccaat gcagcaggaa caggtcgacc agtttttttc gtcgttccaa       600
     ctgtattga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page