(data stored in ACNUC7421 zone)

EMBL: CP000270.PE271

CP000270.PE271       Location/Qualifiers
FT   CDS_pept        complement(306498..306752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4191"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4191"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28809"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D0"
FT                   /protein_id="ABE28809.1"
FT                   /translation="MKQPNDVFNDFQARMSELFKNSPAKDVERNVKAMLSQGFSRLDLV
FT                   TREEFDTQTQVLVRTRARLEELERRVAELEQKLPVTQTP"
     atgaaacaac cgaacgatgt ttttaacgac tttcaggccc gcatgagcga gctgttcaag        60
     aattcgccag ccaaagatgt cgagcgcaac gtgaaagcca tgctgtcgca gggtttttcc       120
     aggctcgacc tggtcacgcg tgaggaattc gatacgcaga cccaggtgct ggtgcgcacg       180
     cgcgcgcgcc tggaggaact ggaacgccgt gtcgccgagc tcgaacagaa gctgccggtc       240
     acgcaaacgc cctaa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page