(data stored in ACNUC7421 zone)

EMBL: CP000270.PE272

CP000270.PE272       Location/Qualifiers
FT   CDS_pept        307164..307502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4190"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4190"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28810"
FT                   /db_xref="GOA:Q146C9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C9"
FT                   /protein_id="ABE28810.1"
FT                   /translation="MKLITAIIKPFKLDEAREALSAIGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVSDDIVDQAIEALERAARTGKIGDGKIFVTPIEQVIRIRT
FT                   GETGADAL"
     atgaaactca ttaccgcaat catcaagccg ttcaagctcg atgaggcgcg cgaagccttg        60
     tcggccatcg gcgtctcggg catcacggtg actgaagtga aaggcttcgg tcgtcagaag       120
     gggcacacgg agctgtaccg cggcgccgaa tacgtcgtcg atttcctgcc gaaggtgaag       180
     atcgaggcgg ctgtctcgga cgacatcgtc gaccaggcga tcgaggcgct ggaacgcgca       240
     gcgcgcaccg gcaagatcgg cgacggcaag atcttcgtca cgccgatcga gcaggtgatc       300
     cggattcgca ccggggagac cggcgcggac gctctgtaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page