(data stored in ACNUC7421 zone)

EMBL: CP000270.PE284

CP000270.PE284       Location/Qualifiers
FT   CDS_pept        319526..319996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4178"
FT                   /product="protein translocase subunit secB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4178"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28822"
FT                   /db_xref="GOA:Q146B7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146B7"
FT                   /protein_id="ABE28822.1"
FT                   /translation="MSDENNQPFFNIQRIYLKDMSLEQPNSPGIFLEQEMPSVEVEVDV
FT                   KAERLAETVFEILVTGTVTAKVSDKVAFLIEAKQAGIFDIRNIPAEQIDPLVGIACPTI
FT                   LFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQMGGQDGAAQNGVTH"
     atgtccgacg agaataacca gccgttcttc aacatccagc gtatctatct gaaggacatg        60
     tcgctcgagc agccgaattc gccgggcatc ttcctcgagc aggaaatgcc gtcggtcgaa       120
     gtcgaagtcg acgtgaaggc cgagcgcctc gccgagacgg tgttcgaaat cctcgtcacg       180
     ggcacggtca cggccaaggt gtcggacaag gttgcgttcc tgatcgaagc caagcaagcc       240
     ggcattttcg acatccgcaa tattcccgcc gagcagatcg acccgctggt cggcattgcc       300
     tgcccgacca tcctgttccc gtacctgcgc tcgaacatcg ccgacgcgat cacccgcgcc       360
     ggtttcccgc cgatccacct cgccgagatc aacttccagg cactgtacga gcaacgcctc       420
     gcgcagatgg gcggccagga cggcgcggcg caaaacggcg tcacgcacta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page