(data stored in ACNUC7421 zone)

EMBL: CP000270.PE286

CP000270.PE286       Location/Qualifiers
FT   CDS_pept        321115..321663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4176"
FT                   /product="Putative appr-1-p processing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4176"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28824"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B5"
FT                   /protein_id="ABE28824.1"
FT                   /translation="MLRFNRCTLEARVVDITELAVDAIVNAANTSLLGGGGVDGAIHRA
FT                   AGKELIRECETLGGCATGDAKLTRGYRLPARYVIHAVGPRWRGGGHGEADLLASCYQRS
FT                   LEVAREAQCTSIAFPAISCGIYHFPADEAVRIALGTVLATLPRTPQIEQVVFACFDDAM
FT                   FARYEAELMRRQAPPSKPV"
     atgctccgtt tcaatcgttg cacgctcgaa gcacgcgtgg tcgacatcac cgaactcgcc        60
     gtggatgcga tcgtcaatgc cgcgaacacg tcgttattgg gcggaggcgg cgtggatggc       120
     gcgattcatc gcgcggccgg caaggaattg atccgcgagt gcgagacgct cggcggctgc       180
     gcgaccggcg acgcgaagct gacacgcggc taccgcttgc cggccagata cgtgattcac       240
     gcagtgggtc cgcgctggcg gggcggcggg catggcgagg ccgatttact ggcgtcctgc       300
     taccagcgtt cgctcgaggt ggcgcgcgag gcgcagtgca cgagcattgc gttccccgcg       360
     atcagttgcg gtatctacca ttttcccgcc gacgaggccg tgcggattgc gctcggcacg       420
     gtgctcgcca ccttgccgcg tacgccgcag atcgaacagg tggtgttcgc ctgtttcgac       480
     gacgccatgt tcgcgcgcta cgaagctgaa ttgatgcgcc gtcaggcgcc gccttcgaag       540
     ccggtctga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page