(data stored in ACNUC7421 zone)

EMBL: CP000270.PE288

CP000270.PE288       Location/Qualifiers
FT   CDS_pept        complement(322125..322910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4174"
FT                   /product="Putative competence protein f-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4174"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28826"
FT                   /db_xref="GOA:Q146B3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B3"
FT                   /protein_id="ABE28826.1"
FT                   /translation="MPLRSISSFSGSRFARFARAVHSAWPRVAQVALPNLCALCGNLSH
FT                   TTICAGCDAAYWNEERLRCTVCAVPLSVTQWAARTQYRCADCAGEPPPFDATFALADYR
FT                   APLDTLAVGLKFRARLMLAHEFGQRLARLAQDSWLELAEWPDVIAPVPLARKRLVERGY
FT                   NQAWQIARPLARALHVRSDATLLHRVIHTAPQSRLDLDARRLNVGRAFKVAGSVQGLHV
FT                   GIVDDVMTTGATLEALARTLKAAGARQVTNFVALRTPKN"
     atgccactcc ggtccatttc gtcgttttcc ggcagccggt tcgcgcgttt tgcgcgcgcc        60
     gtgcattcgg catggccgcg cgtcgcgcag gttgcgctgc ccaatctgtg tgcgttatgt       120
     ggcaatttgt cgcatacgac aatttgcgcc ggttgcgacg cggcctactg gaatgaagag       180
     cggttgcgat gcaccgtctg cgcggtgccg ctatccgtca cgcaatgggc ggcccgcacg       240
     cagtaccggt gcgcggattg cgccggcgag ccgccgccgt tcgacgccac cttcgccctt       300
     gccgactacc gggcgccgct cgacaccctc gcggtcggcc tgaaattccg cgcccgcctg       360
     atgctggcgc acgagttcgg gcaacgcctt gcgcgtcttg cccaggactc gtggctggag       420
     cttgccgaat ggcccgatgt aatcgcgccc gtgccgcttg ccagaaaacg cctcgtcgag       480
     cgcggctata accaggcgtg gcagatcgcg aggccattgg ctcgcgcgct gcatgtgcgc       540
     agcgacgcaa ccttgctgca tcgggtgatt cacaccgcgc cgcagtcgcg gctcgatctc       600
     gacgcccgcc gcctgaacgt aggccgcgct ttcaaggttg caggatccgt gcaaggcctg       660
     cacgtcggca ttgtcgacga tgtgatgacg accggcgcga cgctcgaagc gctggcacgc       720
     acgctcaagg ccgccggtgc gcgccaggtc accaacttcg tcgcgctgcg cacgccgaaa       780
     aactag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page