(data stored in ACNUC7421 zone)

EMBL: CP000270.PE29

CP000270.PE29        Location/Qualifiers
FT   CDS_pept        36117..36911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4434"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28567"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C2"
FT                   /protein_id="ABE28567.1"
FT                   /translation="MKLLKPLLALACAFASLAAASAVSAADTSTLRFGLEAQYPPFESK
FT                   GPNGELQGLDIDVGNAVCAAAHMTCKWVETSFDGLIPALQGRKFDAINSAMNATEQRRQ
FT                   AIDFTTVVYRVPTQLIAKRDSGLLPTTASLKGKRVGVLQSSIQETFAKAHWESAGVTVV
FT                   PYQDQNQVYTDLVAGRLDATLVLAPAGQTGFLSKPNGAGYAFVGEPVRDDRILGSGIAY
FT                   GIRKGDTALRDRLNAAIAKVQADGTVKTLATKYLGNIDVTAK"
     atgaaattgc tcaagcctct attggcactg gcctgcgcat ttgcgtcgct cgcggctgca        60
     tctgccgtga gcgccgccga cacctcgacg ctgcgtttcg gcctcgaagc gcagtatccg       120
     ccgttcgaat cgaaggggcc gaacggggag ttgcagggtc tggatatcga cgtcggcaat       180
     gcggtctgcg ccgctgcgca tatgacctgc aaatgggtcg agacttcgtt cgacgggctg       240
     attcccgcgc tgcagggccg caagttcgac gcgatcaatt cggcgatgaa tgcgaccgaa       300
     caacgccggc aggcgattga tttcaccacc gtcgtgtacc gcgtgccgac gcagctgatc       360
     gcaaagcgcg acagcggtct gctgccgaca acagcctcgc tgaagggcaa acgcgtgggc       420
     gtgttgcagt cgtcgattca ggaaaccttc gccaaggcgc attgggaatc ggcgggcgtg       480
     actgtcgtgc cgtatcagga ccagaaccag gtttatacgg atctcgtggc gggccgtctc       540
     gacgcgacgc tcgtgctggc gccggccgga cagacaggtt ttctgtcgaa gccgaacggc       600
     gccggttacg ccttcgtcgg cgagccggtg cgcgacgaca ggattctcgg tagcggcatt       660
     gcatacggga ttcgcaaggg cgatacggcg ttgcgtgatc gcctgaatgc ggcgatcgca       720
     aaggtgcagg ccgatggtac ggtgaagacg ctggccacga aatatctcgg caatatcgac       780
     gtgacggcga agtga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page