(data stored in ACNUC7421 zone)

EMBL: CP000270.PE290

CP000270.PE290       Location/Qualifiers
FT   CDS_pept        324264..324737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4172"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4172"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28828"
FT                   /db_xref="GOA:Q146B1"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B1"
FT                   /protein_id="ABE28828.1"
FT                   /translation="MEASDLLTDSEPVLKDWTMKRNCSISPRQFICFYVSLAFFSLAIA
FT                   FMLVLVGAWLVLPFTGIELLAVGVAFAIYARHAVDYERIRLFQNRLVIEQVSAEQLTQF
FT                   EFNPRWVRIEAGATPRDRIKLVSRGQTIMIGQHLAQYRRAQFAGELRMWLTRC"
     atggaagcat cagatctgct gacggattca gaaccagttc tcaaagactg gacgatgaaa        60
     cgcaactgtt cgatatcgcc gcggcagttc atatgtttct acgtgtcgct tgcgtttttc       120
     tcgctggcaa ttgctttcat gctggttctg gtcggcgcct ggctggtgtt gccgttcacc       180
     ggtatcgaat tgctggcggt gggcgtcgcg tttgccatat atgcgcgtca tgctgtggat       240
     tacgagcgca tccggttgtt tcagaaccgg ctcgtcatcg agcaggtcag cgccgagcag       300
     ctcacgcagt tcgagttcaa tccgcgctgg gtgcggatcg aggcgggcgc aacgccgcgc       360
     gaccggatca aactggtctc gcgcggccag acgatcatga tcgggcaaca tctcgcgcag       420
     tatcggcgcg cgcagttcgc aggcgaattg cgtatgtggc tcacacgttg ttag             474
//

If you have problems or comments...

PBIL Back to PBIL home page