(data stored in ACNUC7421 zone)

EMBL: CP000270.PE296

CP000270.PE296       Location/Qualifiers
FT   CDS_pept        complement(330380..330589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4166"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4166"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28834"
FT                   /db_xref="GOA:Q146A5"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A5"
FT                   /protein_id="ABE28834.1"
FT                   /translation="MHILVPIAFVLIIASMVSALYFMMHDKGKTKRMVWSLATRVGLSI
FT                   SLFLFILFAHWMGWIQSTGIPYGR"
     atgcacattc tcgttcccat cgccttcgtc ctgatcatcg ccagcatggt gtcggcgctg        60
     tacttcatga tgcatgacaa gggcaaaacc aagcggatgg tctggtcgct cgccacgcgg       120
     gtgggtctgt cgatctcgct gttcctgttc atcctgttcg ctcactggat gggctggatt       180
     caatcgaccg gcattcccta cgggcgctga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page