(data stored in ACNUC7421 zone)

EMBL: CP000270.PE297

CP000270.PE297       Location/Qualifiers
FT   CDS_pept        330701..331417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4165"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28835"
FT                   /db_xref="GOA:Q146A4"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A4"
FT                   /protein_id="ABE28835.1"
FT                   /translation="MKIRLVPALLILLVIVVTVRLGFWQRDRAHQKEALEARITQFENA
FT                   PAQPVSAAPVELKDIEFHHVKARGSFVADKVVYLDNRPYNDQPGFYVVMPFKLADGGYV
FT                   LVNRGWLPRNMNNRETIAPYTTPQGEIEIEGIARADASRAFELGQGGSAEHQLIRQNLD
FT                   TAAYAAETGLPLQSFVIQQLSDDGDQLVRDWPAPTNGVERNYGYMFQWWGMAAAALVFG
FT                   LYAARRAAKKEHAPGV"
     atgaagattc gcctcgtgcc cgcgctgctg attctgctgg tgatcgtggt aaccgtgcgg        60
     ctgggtttct ggcagcgcga ccgcgcgcat cagaaggaag cgctcgaagc gcgcatcacg       120
     cagttcgaga acgcgcccgc gcagccggtg agcgccgcgc cggtcgaact gaaggacatc       180
     gagtttcatc acgtgaaggc gcgcggcagt ttcgtcgcgg ataaagtcgt ctacctcgat       240
     aatcgtccgt ataacgacca gccgggcttt tacgtcgtga tgccttttaa actggccgac       300
     ggcggctacg tgctggtcaa tcgcggctgg ctgccgcgca acatgaacaa tcgcgaaacc       360
     atcgcgccgt acacgacgcc gcaaggcgaa atcgaaatcg aaggcattgc gcgggcggac       420
     gcgtcgcgtg ctttcgagtt ggggcagggt ggttcggccg agcatcagct gatccgccag       480
     aatctggaca ccgccgcgta cgccgcggaa accggcctgc cgctgcagtc gttcgtgatc       540
     cagcaattga gcgacgacgg cgaccaactg gtgcgcgact ggcccgcgcc taccaacggc       600
     gtcgagcgca actatggcta catgttccag tggtggggca tggcggccgc ggcgctggtc       660
     ttcggcctgt atgccgcgcg ccgcgccgcg aagaaagagc acgcgccggg cgtgtaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page