(data stored in ACNUC7421 zone)

EMBL: CP000270.PE3

CP000270.PE3         Location/Qualifiers
FT   CDS_pept        3266..5737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4460"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4460"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28541"
FT                   /db_xref="GOA:Q147E8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E8"
FT                   /protein_id="ABE28541.1"
FT                   /translation="MTETNNSQPDNSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGLH
FT                   HLVFEVLDNSIDEALAGHCNDIQVIIHADNSISITDNGRGVPTGLKMDDKHDPKRSAAE
FT                   IVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSAWLRLTIRRDGKKHFMEFHRGVPQ
FT                   NRIIEEIDGVAVSPIQVTGETENRGTEVHFLADETIFGNIEYHYDILAKRIRELSFLNN
FT                   GVRIKLTDQRTGKEEDFAFVGGVKGFVEYINKNKSVLHPNIFHISGEKDGVGVEVAMQW
FT                   NDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVLNKYINDHEVAKKAKVETSGDDMRE
FT                   GLSCVLSVKVPEPKFSAQTKDKLVSSEVRAPVEDVVAKALEEFLLETPNDAKIICSKIV
FT                   DAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKSEIYIVEGDSAGGSAKQG
FT                   RDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLITALGCGIGKEDYNLDKLRYHRII
FT                   IMTDADVDGAHIRTLLLTFFYRQMPEMIERGYIYIAQPPLFKIKAGKDERYLKDEAEVN
FT                   AHILKLALQGSELLASEGATPITGDALGELARAYLLAQAVVNRLSRLYDAGALEAVMDG
FT                   VVVDLSSEEAAEVSAAALEAKLRDDALKPEVKVTTMYDPVRELRSLRVARTHHGNQKIS
FT                   VLDQDFQLTADYQQLINTANTFKGLIGTGAVIKRGERSMAVTDFKSAMKWLLADAERNI
FT                   SKQRYKGLGEMNPGQLWETTMDPTVRRLLRVQIEDAIAADGIFTTLMGDDVEPRRAFIE
FT                   SNALRAGNIDV"
     atgactgaaa cgaacaattc gcaacccgac aacagctacg gcgcatcctc gattcagatc        60
     ctcgaaggtc tggaggcggt gcgcaagcgg cccgggatgt acatcgggga tacatcggac       120
     gggaccggtc tgcatcacct cgtatttgaa gtgctggaca actccatcga cgaagcgttg       180
     gcggggcatt gcaacgacat ccaggtgatc attcacgcgg acaactccat ttccatcacc       240
     gacaacggcc gcggcgtgcc gaccggcctg aagatggacg acaagcacga tccgaagcgc       300
     agcgccgctg aaatcgtgat gaccgagttg cacgccggcg gcaagttcga ccagaacagc       360
     tacaaggtgt ccggcggcct gcacggcgtg ggcgtgtcgt gcgtgaacgc attgtccgcg       420
     tggctgcgtt tgaccattcg ccgcgacggc aagaagcact tcatggaatt ccaccgtggc       480
     gtgccgcaga accgcattat cgaagagatc gacggcgtgg ctgtttcgcc gattcaagtc       540
     accggcgaga ccgaaaaccg cggcaccgaa gtgcactttc tcgccgacga gacgattttc       600
     ggcaacatcg aatatcacta cgacattctg gccaagcgga ttcgcgaact gtcgttcctg       660
     aataacggcg tgcgaatcaa gctgaccgat cagcgcaccg gcaaggaaga agatttcgcg       720
     ttcgtaggcg gcgtgaaggg ctttgtcgag tacatcaaca agaacaagtc cgtgctgcac       780
     ccgaacattt tccacatcag cggcgagaaa gacggcgtgg gcgtggaagt ggcgatgcag       840
     tggaacgaca gctacaacga aaacgtgctg tgcttcacga acaacattcc gcagcgcgat       900
     ggtgggacgc acctgaccgg attgcgtgcg gcgatgacgc gcgtgttgaa caagtacatc       960
     aacgatcacg aagttgcgaa gaaggcgaag gtcgagactt ctggcgacga tatgcgtgaa      1020
     gggttgtcgt gcgtgttgtc ggtgaaggtg ccggagccga agttcagcgc gcagacgaag      1080
     gacaagctgg tgtcgtcgga agtgcgcgcg ccggtggagg atgtggtcgc gaaggcgctc      1140
     gaagagtttc tgctcgagac gccgaatgac gcgaagatta tttgcagcaa gattgtcgat      1200
     gccgcgcgcg cgcgggatgc ggcccggaag gcgcgtgaaa tgacgcgtcg caagggtgtg      1260
     ctcgacggcg tgggtctgcc tgggaagctg gcggattgcc aggagaagga cccggcgaag      1320
     tccgagattt atatcgtcga aggtgactcg gcaggcgggt cggccaagca gggccgggat      1380
     cggaagtttc aggcgatttt gccgctgcgc ggcaaggtgc tgaatgtgga gaaggcgagg      1440
     tatgacaagc tgctttcttc ggagcagatt gttacgctga ttactgctct cggttgcggg      1500
     attggtaagg aagactacaa cctcgataag ctgcgttatc accgcatcat catcatgacc      1560
     gatgctgacg ttgacggtgc gcacatccgg acgttgttgc tgacgttctt ctatcggcag      1620
     atgccggaga tgatcgagcg tgggtatatc tatatcgcgc agccgccgct gttcaagatc      1680
     aaggcgggca aggacgaacg gtatttgaag gatgaggctg aggtcaatgc tcacattctg      1740
     aagctggcgt tgcaggggtc ggagttgctc gcttcggaag gcgctacgcc gattactgga      1800
     gatgcgttgg gtgagttggc tcgggcttat ctgttggctc aggctgtggt taatcgtttg      1860
     agccggttgt atgacgctgg ggcgctcgag gctgtgatgg atggggtcgt tgtcgatctg      1920
     tccagcgagg aagcggctga agtgtcggcg gcggcgcttg aggccaagtt gcgggatgat      1980
     gcgttgaagc ctgaagttaa ggtcacgacg atgtatgacc cggttcgtga actgcgctcg      2040
     ctgcgggttg cgcggacgca tcacgggaat cagaagattt ctgtgctgga tcaggatttt      2100
     cagctcactg ctgattacca gcagctgatc aacaccgcta atacgtttaa ggggttgatt      2160
     gggacgggtg ccgtcatcaa acgtggcgaa cggagtatgg ctgttactga cttcaagtcc      2220
     gctatgaagt ggttgttggc tgatgccgag cgaaatatct cgaagcagcg ctataagggc      2280
     ctcggtgaaa tgaatcctgg gcagctttgg gagactacga tggatccgac ggtgcgtcgt      2340
     cttcttcggg tgcagatcga ggatgctatt gcggctgatg gcattttcac cacgctcatg      2400
     ggggatgatg tggagccgcg tagggcgttt attgagtcga atgcgttgcg ggcggggaat      2460
     atcgacgttt ga                                                          2472
//

If you have problems or comments...

PBIL Back to PBIL home page