(data stored in ACNUC7421 zone)

EMBL: CP000270.PE311

CP000270.PE311       Location/Qualifiers
FT   CDS_pept        347329..348651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4151"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4151"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28849"
FT                   /db_xref="InterPro:IPR018535"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z0"
FT                   /protein_id="ABE28849.1"
FT                   /translation="MSMRSAICLMFFLPAGVAYAGGQFNVQCAYSHTLPDDAIIYPGQP
FT                   GRAMVHDFFGNTGADAYSTYYSLNDNKVSTCNVAADPSSYWVPQLKRASGIVVPGYQKT
FT                   YYKNDQPVVPLHTIPAGLEMLAGDHRSSSPKPQINYLCRGGSYTQIAPTRCPVVTDSSG
FT                   TYAQLDISVHFPDCWDGRTLVPSMASHIMNMAYRQADGKCPAAYPVKIPELQLNVAYDL
FT                   GQDPDLSTAQLSMDPILVNGTWVPQWGSLYTAHADFINAWKIDSLQYAVDNCSNADIAC
FT                   SNSIPTYYSKASADVWMDGSGVAHASDSTMISDAASTVLIKFPTPTDLKDYPYTNSYLQ
FT                   TLAQNVTDTSAVTLDIYAASTNWNDTANLPTTAACNTNQRIGGIYLDNALQPRINDITR
FT                   YVASQVAAGASQIGVCIRNATGRTVQISSRDGTRTPALFMK"
     atgtcaatgc gatcagcaat ctgtttgatg ttcttcctgc cggccggcgt cgcttatgcc        60
     ggtggccagt tcaacgtcca atgcgcgtat tcgcatacgc tgcctgacga tgcgatcatc       120
     tatccaggcc agcctggcag ggctatggtg catgactttt tcgggaacac cggtgccgat       180
     gcatacagta cgtactactc gctgaacgac aacaaggtga gcacctgtaa tgtcgcggcg       240
     gatccttcgt cgtactgggt tccgcagtta aagcgcgcgt cgggaattgt agtgccgggc       300
     tatcagaaga cctactacaa gaacgatcaa ccggtggttc cgctgcacac gatcccagcg       360
     gggctggaaa tgctggcggg cgatcatcgt tcatcctcgc ccaagccgca gatcaactat       420
     ctgtgccgcg gcggttccta cacgcaaatc gcgccgaccc gctgccctgt cgtaacggac       480
     agcagcggca cctacgcgca gctggatatc tccgtgcatt ttccggattg ctgggacggc       540
     cggaccctgg tgccgagcat ggccagtcac atcatgaata tggcctaccg gcaggccgac       600
     ggcaaatgtc cagccgcgta tccggtcaag attcctgaat tgcaactcaa cgttgcatac       660
     gacctcggcc aggatcctga tctctccacc gcgcaattgt cgatggaccc gattctcgtg       720
     aatggcacgt gggtgccgca gtggggaagc ctgtacacgg cgcacgccga tttcatcaac       780
     gcctggaaga tcgattcgct gcaatacgcg gtcgacaact gctccaatgc ggatatcgcg       840
     tgcagcaaca gcattccgac gtattactcg aaggcgagcg ccgatgtgtg gatggacggc       900
     agtggtgtcg cgcatgcgag cgatagcacg atgatctcgg acgcggcaag taccgtgttg       960
     atcaaatttc cgacgcccac cgacctgaag gattatccgt acaccaattc gtatctgcag      1020
     acgcttgcgc agaacgtgac ggatacgagc gcggtgacgc tggatattta cgctgcttcc      1080
     acgaactgga atgacaccgc gaacctgcca acgacggcgg cctgcaacac gaatcagcgc      1140
     atcggcggca tctacctgga taacgcgctg cagccgcgca tcaacgacat tacgcgctat      1200
     gtcgcgtctc aagtcgccgc gggcgcgtcg cagatcggcg tttgcattcg caacgcgact      1260
     ggccggaccg tgcagatttc ttcacgcgac ggtacacgaa cacccgcgct gttcatgaag      1320
     tag                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page