(data stored in ACNUC7421 zone)

EMBL: CP000270.PE312

CP000270.PE312       Location/Qualifiers
FT   CDS_pept        complement(348772..348888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4150"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4150"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28850"
FT                   /db_xref="GOA:Q145Y9"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y9"
FT                   /protein_id="ABE28850.1"
FT                   /translation="MWYFSWILGIGVALAFGIINVMWLESRRPLEAGKPKTH"
     atgtggtatt tcagttggat tctcggaatc ggcgtggcgt tggcgttcgg tatcatcaac        60
     gtgatgtggc tcgaatcgcg ccggccgctg gaagcgggca agcctaagac gcattga          117
//

If you have problems or comments...

PBIL Back to PBIL home page